All public logs
Jump to navigation
Jump to search
Combined display of all available logs of XenWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).
- 12:46, 4 December 2023 Xenbase talk contribs created page XB-FEAT-29078026 (Created page with "=''chst1l''= =protein > homology group> nomenclature notes= 12.04.2023 protein: carbohydrate sulfotransferase 1 [Xenopus laevis] NCBI Reference Sequence: XP_018107451.1 >XP_018107451.1 carbohydrate sulfotransferase 1 [Xenopus laevis] MECSWKAVVLLVFASLGIQYTAIKSLRTAFKSPCQVMGGESRCFQRDLRDNASRLLCEDLGQVNRKHIIL LATTRSGSSFLGQIFNQNPDIFYLYEPLYHVQRAFTNSSTRMQKQIDRRSLLGAYRDLLHNLYNCDFYFL ENYLRPAPKDHETTSFFRRGASNALCLPPVCEQLHPIEEHLCSKKCRTVNLTLVSKSCHQYKHMAIKTVR IPEINDIRTLVEDPRLNLKVIH...")