User contributions for Xenbase
Jump to navigation
Jump to search
2 January 2024
- 09:1609:16, 2 January 2024 diff hist +310 XB-FEAT-493297 →prpf4 current
18 December 2023
- 12:3112:31, 18 December 2023 diff hist −10 XB-FEAT-5886445 →c10h17orf80 current
- 12:3012:30, 18 December 2023 diff hist +164 XB-FEAT-5886445 →nomenclature changes
14 December 2023
- 13:5713:57, 14 December 2023 diff hist +4 XB-FEAT-22164454 →tff3.5
- 13:5713:57, 14 December 2023 diff hist +399 N XB-FEAT-22164454 Created page with "=tff3.5= This is the Xenbase community wiki page for ''Xenopus ''tff3.5'' genes. Please feel free to record here any relevant information about these ones, that is not already represented on the gene page or elsewhere on Xenbase. =genome annotation notes= 12DEC2023 note that ''tff3.5.S'' is not annoatated on the ''X. laevis'' v10 genome release. We looked, and couldn't find a v10.1 model for it."
11 December 2023
- 11:1911:19, 11 December 2023 diff hist +139 XB-FEAT-29084766 →protein current
- 10:5110:51, 11 December 2023 diff hist +35 XB-FEAT-29084766 →synteny
- 10:4910:49, 11 December 2023 diff hist +289 XB-FEAT-29084766 →homology group analysis via EggNOGG v5
- 10:4810:48, 11 December 2023 diff hist −270 XB-FEAT-29084766 →nomenclature changes
- 10:4810:48, 11 December 2023 diff hist +57 XB-FEAT-29084766 →homology group analysis via EggNOGG v5
- 10:2510:25, 11 December 2023 diff hist 0 XB-FEAT-29084766 →synteny
- 10:2410:24, 11 December 2023 diff hist +501 XB-FEAT-29084766 →homology group analysis via EggNOGG v5
- 10:2410:24, 11 December 2023 diff hist −8 XB-FEAT-29084766 →synteny
- 10:2110:21, 11 December 2023 diff hist +2,020 N XB-FEAT-29084766 Created page with " =protein= uncharacterized protein '''LOC101730711''' [Xenopus tropicalis] NCBI Reference Sequence: XP_017952313.2 >XP_017952313.2 uncharacterized protein LOC101730711 [Xenopus tropicalis] MCHILIFILLFLFLFQRKICEGRGRLSCPAVMGPARLHPFIILLGLFHLFLSSTSAVKVENFTLFEEKLK LEAHTANMIPCVFHTRRRLNPLRVQLEWGKMDKEGYVPLIHLDGNHVRKAAADFGDKYQLFIPQVSQGNC SLVINPMDIADSGTYQVRLRILGKLYEPVPSIEIQVVDQRKVESRAWGKKKTTVPPTTIATVPPGFVDDV QKRLVKIDKMAIIAIILNGVFVGIAILLGVLVFITYRKKSSSGDEENPPKKRKQKGKKEPSDESEESSSS..."
5 December 2023
- 15:2515:25, 5 December 2023 diff hist +1 XB-FEAT-483692 →pax8 current
- 10:3410:34, 5 December 2023 diff hist +14 N XB-FEAT-22169226 Created page with "=''chst9l.2''=" current
- 10:3310:33, 5 December 2023 diff hist −6 XB-FEAT-967555 →chst9l.2 current
- 10:3310:33, 5 December 2023 diff hist +10 XB-FEAT-967555 →chst7
4 December 2023
- 14:5414:54, 4 December 2023 diff hist −6 XB-FEAT-483692 No edit summary Tag: Manual revert
- 14:5314:53, 4 December 2023 diff hist +6 XB-FEAT-483692 No edit summary Tag: Reverted
- 13:4613:46, 4 December 2023 diff hist +1,388 N XB-FEAT-29078026 Created page with "=''chst1l''= =protein > homology group> nomenclature notes= 12.04.2023 protein: carbohydrate sulfotransferase 1 [Xenopus laevis] NCBI Reference Sequence: XP_018107451.1 >XP_018107451.1 carbohydrate sulfotransferase 1 [Xenopus laevis] MECSWKAVVLLVFASLGIQYTAIKSLRTAFKSPCQVMGGESRCFQRDLRDNASRLLCEDLGQVNRKHIIL LATTRSGSSFLGQIFNQNPDIFYLYEPLYHVQRAFTNSSTRMQKQIDRRSLLGAYRDLLHNLYNCDFYFL ENYLRPAPKDHETTSFFRRGASNALCLPPVCEQLHPIEEHLCSKKCRTVNLTLVSKSCHQYKHMAIKTVR IPEINDIRTLVEDPRLNLKVIH..." current
- 13:0113:01, 4 December 2023 diff hist +312 XB-FEAT-960884 →chst6 current
30 November 2023
- 08:2608:26, 30 November 2023 diff hist +3 XB-FEAT-1000743 →synteny map
- 08:2508:25, 30 November 2023 diff hist +179 XB-FEAT-1000743 →synteny map
- 08:2008:20, 30 November 2023 diff hist +813 XB-FEAT-1000743 →synteny map
- 08:2008:20, 30 November 2023 diff hist +815 XB-FEAT-483145 →synteny current
- 07:5107:51, 30 November 2023 diff hist +12 XB-FEAT-1000743 No edit summary
- 07:4907:49, 30 November 2023 diff hist −51 XB-FEAT-1000743 →synteny map
- 07:4607:46, 30 November 2023 diff hist +978 N File:Six6 synteny.png No edit summary current
- 07:4307:43, 30 November 2023 diff hist +751 XB-FEAT-1000743 →nomenclature changes
29 November 2023
- 14:2214:22, 29 November 2023 diff hist −1 XB-FEAT-483145 →six6
- 14:2114:21, 29 November 2023 diff hist +19 XB-FEAT-483145 →synteny
- 14:1614:16, 29 November 2023 diff hist +169 XB-FEAT-483145 →synteny
- 14:1114:11, 29 November 2023 diff hist +132 XB-FEAT-483145 →six6
- 10:1210:12, 29 November 2023 diff hist +1,135 XB-FEAT-6257418 No edit summary current
- 08:1408:14, 29 November 2023 diff hist −385 XB-FEAT-22065720 →Summary from NCBI current
- 08:1308:13, 29 November 2023 diff hist +503 XB-FEAT-22065720 →nomenclature notes
- 08:0908:09, 29 November 2023 diff hist −1 XB-FEAT-22065720 →nomenclature notes
- 08:0908:09, 29 November 2023 diff hist −2 XB-FEAT-22065720 →nomenclature notes
20 November 2023
- 10:5510:55, 20 November 2023 diff hist +995 XB-FEAT-992773 No edit summary current
- 10:0010:00, 20 November 2023 diff hist +38 XB-FEAT-6049731 →Synteny current
- 09:4109:41, 20 November 2023 diff hist +1,353 XB-FEAT-6049731 →gabra6
- 09:0909:09, 20 November 2023 diff hist +416 XB-FEAT-992773 →gabra3
30 October 2023
- 13:2913:29, 30 October 2023 diff hist +1,982 Reporting Bugs →Reporting a bug in Xenbase current
18 October 2023
- 14:3714:37, 18 October 2023 diff hist +1,578 XB-FEAT-5959819 →unnamed current
- 14:3714:37, 18 October 2023 diff hist −753 XB-FEAT-940811 →synteny current Tag: Blanking
- 14:3714:37, 18 October 2023 diff hist −823 XB-FEAT-940811 →nomenclature changes
- 14:3714:37, 18 October 2023 diff hist −190 XB-FEAT-940811 →gpr4l
- 14:2214:22, 18 October 2023 diff hist +4 XB-FEAT-940811 →gpr4l
- 14:2214:22, 18 October 2023 diff hist +16 XB-FEAT-940811 →synteny
- 14:2114:21, 18 October 2023 diff hist +1,565 XB-FEAT-940811 →gpr4
- 14:2114:21, 18 October 2023 diff hist +8 XB-FEAT-5853032 →nomenclature changes current
- 14:1514:15, 18 October 2023 diff hist +14 XB-FEAT-5853032 →nomenclature changes
- 14:1414:14, 18 October 2023 diff hist +1,540 XB-FEAT-5853032 →mgc69520
- 14:1214:12, 18 October 2023 diff hist +108 N File:Screenshot 2023-10-18 at 4.10.09 PM.png No edit summary current
- 13:3813:38, 18 October 2023 diff hist +549 N XB-FEAT-18034121 Created page with "=''rho.2''= This is the community wiki page for the ''Xenopus rho.2'' genes. Please add here any relevant information pertaining to these genes, if it is not represented elsewhere on Xenbase. =annotation and synteny= Note that this gene is a duplicate of the adjacent ''rho'' gene, on Chromosome 4, but is only seen in ''X. laeivs'' L subgenome. In v10 assemblies: ''Xtr.chr4: mbd4< ift122> rho> h1-8> plxnd1<'' ''Xla.4L:mbd4.L< ift122.L> rho.L> '''rho.2.L>''' h1-8.L>..." current
- 12:3012:30, 18 October 2023 diff hist +5 XB-FEAT-1018916 →tmtopn3 current
- 12:3012:30, 18 October 2023 diff hist +18 XB-FEAT-1018916 →gene nomenclature
- 12:1112:11, 18 October 2023 diff hist +496 XB-FEAT-22065720 →summary from NCBI
- 12:0112:01, 18 October 2023 diff hist +174 XB-FEAT-22065720 →opn7a
- 12:0012:00, 18 October 2023 diff hist +392 N XB-FEAT-22065720 Created page with "=opn7a= =summary from NCBI= Predicted to enable G protein-coupled receptor activity and photoreceptor activity. Acts upstream of or within phototransduction. Predicted to be located in membrane. Predicted to be integral component of membrane. Is expressed in several structures, including brain; digestive system; eye; heart; and testis. [provided by Alliance of Genome Resources, Apr 2022]"
- 06:4206:42, 18 October 2023 diff hist +306 XB-FEAT-6076481 →rrh current
17 October 2023
- 13:0213:02, 17 October 2023 diff hist +4 XB-FEAT-29083966 →opn6bl Tag: Manual revert
- 13:0213:02, 17 October 2023 diff hist −4 XB-FEAT-29083966 No edit summary Tags: Manual revert Reverted
- 13:0213:02, 17 October 2023 diff hist +4 XB-FEAT-29083966 →opn6bl Tag: Reverted
- 13:0113:01, 17 October 2023 diff hist +803 N XB-FEAT-29083966 Created page with "= opn6bl= This is the Xenbase wiki page for the Xenopus genes 'opn6bl''. Fee; free to record anything here about these genes a=thata are not recorded elsewhere on Xenbase. =nomenclature changes= 18OCT2023 The gene symbol and names for the opsin gens where updated, provisionally, replacing the ''LOC 100497987, visual pigment-like receptor peropsin'' with ''opn6bl, visual pigment-like receptor peropsin 6b like'', which combines the X.tropicalis gene /protein name with th..."
- 12:2212:22, 17 October 2023 diff hist +1,160 XB-FEAT-1018914 →tmtops current
- 12:2012:20, 17 October 2023 diff hist −6 XB-FEAT-990435 →gene nomenclature current
- 12:1712:17, 17 October 2023 diff hist +1,163 XB-FEAT-1018916 →tmtops.2
- 12:1512:15, 17 October 2023 diff hist −4 XB-FEAT-990435 →gene nomenclature
- 12:1312:13, 17 October 2023 diff hist +3 XB-FEAT-990435 →tmtopn2
- 12:1312:13, 17 October 2023 diff hist +1,160 XB-FEAT-990435 →loc100490436
- 08:3808:38, 17 October 2023 diff hist +1 XB-FEAT-5826965 →LOC373730 current
- 08:0008:00, 17 October 2023 diff hist +63 XB-FEAT-5826965 →nomenclature changes
- 07:4007:40, 17 October 2023 diff hist 0 XB-FEAT-5729392 →mrps36 current
- 07:4007:40, 17 October 2023 diff hist +338 XB-FEAT-5729392 →mrps36
10 October 2023
- 09:4509:45, 10 October 2023 diff hist +13 XB-FEAT-989872 →nomenclature notes current
- 09:4509:45, 10 October 2023 diff hist +288 XB-FEAT-989872 →nomenclature notes
- 08:0308:03, 10 October 2023 diff hist +2,724 N XB-FEAT-22063928 Created page with "=''notch4''= This is the community wiki page for the gene ''notch4'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase. =gene nomenclature and annotation notes= In ''X. laevis'', on chromosome 8L, LOC121397048 is the gene next to ''tap2.L'' and we propose that represents a non-coding fragment of ''notch4''. This annotation was based on BLAST of notch4.S XM_041575228.1, which identified the loci n..." current
9 October 2023
- 14:4914:49, 9 October 2023 diff hist 0 N File:Undefined-4.pdf No edit summary current
- 14:4814:48, 9 October 2023 diff hist 0 N File:Undefined-3.pdf No edit summary current
- 14:4814:48, 9 October 2023 diff hist +1,421 XB-FEAT-22062677 →synteny current
- 14:3814:38, 9 October 2023 diff hist +4 XB-FEAT-22062677 →gja4
- 14:3114:31, 9 October 2023 diff hist +153 XB-FEAT-22062677 →nomenclature changes
- 14:2914:29, 9 October 2023 diff hist +239 XB-FEAT-22062677 →nomenclature
- 14:2414:24, 9 October 2023 diff hist 0 XB-FEAT-22062677 →cx38
- 13:0713:07, 9 October 2023 diff hist +31 XB-FEAT-22062677 →synteny
- 13:0413:04, 9 October 2023 diff hist +18 XB-FEAT-22062677 →nomenclature
- 13:0313:03, 9 October 2023 diff hist +86 XB-FEAT-22062677 →nomenclature
- 13:0213:02, 9 October 2023 diff hist +1,354 N XB-FEAT-22062677 Created page with "=''cx38''= This is the community wiki page for the gene ''cx38'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase. =nomenclature= 09 OCTOBER 2023 Note: no other vertebrate genes are called ''cx38'', just ''X. trop'' GeneID:100170463, and ''X. laevis'' GeneID:397866. The Synonym given is ''gja2'', which in NCBI is currently only assigned to genes in a large number of fish species, but no other vert..."
6 October 2023
- 11:3511:35, 6 October 2023 diff hist +6 Stage 44 No edit summary current
5 October 2023
- 15:1715:17, 5 October 2023 diff hist 0 Stage 44 No edit summary
- 15:1415:14, 5 October 2023 diff hist 0 N File:Stage44ventral.jpg No edit summary current
- 15:1315:13, 5 October 2023 diff hist +4 Stage 44 No edit summary
- 15:1315:13, 5 October 2023 diff hist −1 Stage 44 No edit summary
- 13:2213:22, 5 October 2023 diff hist 0 File:Herbimycin.png Xenbase uploaded File:Herbimycin.png current
- 10:5110:51, 5 October 2023 diff hist 0 File:Krylov FISH-TSA protocol.pdf Xenbase uploaded File:Krylov FISH-TSA protocol.pdf current
- 10:5010:50, 5 October 2023 diff hist 0 File:Slc45a2 - Start Codon - Consensus.pdf Xenbase uploaded File:Slc45a2 - Start Codon - Consensus.pdf current
- 10:5010:50, 5 October 2023 diff hist 0 File:Slc45a2 - tBLASTn.pdf Xenbase uploaded File:Slc45a2 - tBLASTn.pdf current
- 10:4910:49, 5 October 2023 diff hist 0 File:Slc45a2 - Multi-sequence alignment.pdf Xenbase uploaded File:Slc45a2 - Multi-sequence alignment.pdf current