XB-FEAT-22068108: Difference between revisions
(Created page with " =orthology inference from protein sequence= the Xtrop protein accession XP_031756970.1 matches C3orf62 genes in DIOPT/EggNog Orthologs group, with 67 proteins in 67 specie...") |
|||
Line 1: | Line 1: | ||
= nomenclature changes = | |||
5DEC2022 | |||
HGNC and NCBIs RefSeq team have recently renamed all non-human open reading frame (ORF) genes. The new Xenopus gene symbol syntax reflects the orthology to the human gene while starting with a prefix indictating location of the ORF on the Xenopus chromosome, i.e., the Xenopus chromosome number (c#), then 'h#' for the human chromosome number, then the same human 'orf #'. Old human 'c'orf' gene symbols are recorded as synonyms. | |||
=orthology inference from protein sequence= | =orthology inference from protein sequence= |
Revision as of 15:28, 25 May 2023
nomenclature changes
5DEC2022
HGNC and NCBIs RefSeq team have recently renamed all non-human open reading frame (ORF) genes. The new Xenopus gene symbol syntax reflects the orthology to the human gene while starting with a prefix indictating location of the ORF on the Xenopus chromosome, i.e., the Xenopus chromosome number (c#), then 'h#' for the human chromosome number, then the same human 'orf #'. Old human 'c'orf' gene symbols are recorded as synonyms.
orthology inference from protein sequence
the Xtrop protein accession XP_031756970.1 matches C3orf62 genes in DIOPT/EggNog Orthologs group, with 67 proteins in 67 species, incluidng Anolis carolinensis 28377.ENSACAP00000007824 C3orf62; Otolemur garnettii 30611.ENSOGAP00000001669 C3orf62; Pteropus vampyrus 132908.ENSPVAP00000008242 C3orf62; Monodelphis domestica 13616.ENSMODP00000016265 C3orf62; Pongo abelii 9601.ENSPPYP00000015524 C3orf62; Homo sapiens 9606.ENSP00000341139 C3orf62; an dCanis lupus 9612.ENSCAFP00000017130 C3orf62.
So I'm confodent this uncharacterised LO geen is the Xtropicalis C3orf62 ortholog!
protein accession FASTA
uncharacterized protein LOC116410455 [Xenopus tropicalis]
NCBI Reference Sequence: XP_031756970.1
>XP_031756970.1 uncharacterized protein LOC116410455 [Xenopus tropicalis]
MSEKLRRCRKEFSEAISRVLENSGLPYFIHLHAYHYPAGYMKSVPTKSIVCENVVTMPFCVQLHMIPEHP
FSHPPEAKRPGQHSLSLDLEQTPQSSISSFTDSQEDITGTLLELIESTNYRVMAKTYETVESEVDLSILY
GLCPGSPSYGATMPLVSKKAAADASAVPAPLTDEEDCRIIEMVLDMEEDYCCQTQTCAHLT