XB-FEAT-29071333: Difference between revisions

From XenWiki
Jump to navigation Jump to search
Line 27: Line 27:
Protein alignment in DIOPT/EggNog to look for homology groups is inconclusive- with only 2 matched with very low confidence scores. BLAST does not identif any other sugnificant results
Protein alignment in DIOPT/EggNog to look for homology groups is inconclusive- with only 2 matched with very low confidence scores. BLAST does not identif any other sugnificant results


As 'atrx2'  gene symbol is not used anywhere else, I am changing it to ''atrxl' (another like gene) and removing the human orthologs from the gene page.
=nomenclature changes=
07 JUNE 2023
 
As 'atrx2'  gene symbol is not used anywhere else, I am changing gene symbol from ''atrx2'' to ''atrxl' (another like gene)  
 
THis gene is not a true ortholog of Human ATRX, so I am also  removing all orthologs from this gene page.


=Protein=
=Protein=

Revision as of 13:47, 8 June 2023

atrx2

This is the community wiki page for the Xenopus atrx2 genes. Please feel free to record here any relvant information that is not recorded elsewhere on Xenbase.

Xenopus artx genes

There are 2 different 'atrx' genes identified in Xenopus v10 assembly.

atrx, ATRX chromatin remodeler gene on XB-GENEPAGE-980567 for Xtropicalis and Xlaevis L and S subgenomes all on Chr8/8L/8S

atrx2, ATRX chromatin remodeler on XB-GENEPAGE-29071333 which currently only has a X.laevis.L gene model on Chr1L

atrx genes on XB-GENEPAGE-980567 are accepted as the true orthologs to Human ATRX, as recognized by NCBi and support by synteny.

  • Xtr chr8 klf4a< fgf16> atrx< magt1< cox7b> atp7a>
  • Human chrX: FGF16> ATRX< MAGT1< COX7B < ATP7A<


The identify of ‘atrx2’ is however unclear.

Synteny does NOT indicate any similarly positioned/named gene in other species or human:

  • Xla chr1L: abcg2.L> pkd.L< atrx2.L< ibsp.L< LOC> dspp.L<
  • HUMAN CHR4: NUDT9> SPARCL1< DSPP> DMP1> IBSP> MEPE> SPP1> PKD2>

Protein alignment in DIOPT/EggNog to look for homology groups is inconclusive- with only 2 matched with very low confidence scores. BLAST does not identif any other sugnificant results

nomenclature changes

07 JUNE 2023

As 'atrx2' gene symbol is not used anywhere else, I am changing gene symbol from atrx2 to atrxl' (another like gene)

THis gene is not a true ortholog of Human ATRX, so I am also removing all orthologs from this gene page.

Protein

transcriptional regulator ATRX homolog [Xenopus laevis]

NCBI Reference Sequence: XP_018107822.1

>XP_018107822.1 transcriptional regulator ATRX homolog [Xenopus laevis] MVFTQKMKTVLLFVCLFGIAFAYSNSSSSESSESSKSDSSDSSSEENQTAGPVVTAKRLSNLRGDSYRPRRDLLLNLLKRDLKGKKRGSSSSSDEDSTTHSEDRSAVTKSTSTHSHSSESSEEHTNPTLQKVAFTPEPNTSEESSEERTTKLPIV

synteny patterns