XB-FEAT-5934217: Difference between revisions

From XenWiki
Jump to navigation Jump to search
Line 1: Line 1:
=''fdx1''=  
=''fdx1.2''=  
This is the community wiki page for the gene ''fdx1'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.
This is the community wiki page for the gene ''fdx1.2'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.


=orthology/homology analysis=
=orthology/homology analysis=

Revision as of 11:31, 26 April 2023

fdx1.2

This is the community wiki page for the gene fdx1.2 please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.

orthology/homology analysis

DIOPT/EggNog identifies this protein [below] as a Ferredoxin with very high certainty, matching =protein=~900 Eukaryote proteins from ~465 species, including the Xenopus accession: FDX1L; ENSXETP00000046485

>XP_002936827.1 adrenodoxin [Xenopus tropicalis]

MAHRTLGFLQRLLPALCGNKSLPCRAVTHTNSICAARGITTTPQRQDALFSSGDSDDKITVNFINRNGET LTATAKEGESLLEVVIRHHLNIDGFGACEGTLACSTCHLIFDKKVYEKLSAVSDEEMDMLDLAFGLTETS RLGCQVCMTKALDGLTVRVPVDVSDARRETEVGKQSKQ

nomenclature changes

Based on above analysis, gene symbol updated, changing from fdx1b to fdx1