XB-FEAT-982798: Difference between revisions

From XenWiki
Jump to navigation Jump to search
 
(One intermediate revision by the same user not shown)
Line 1: Line 1:
= ''mgc69473'' =  
=''rbm43l'' =  
This is the community wiki page for the gene ''mgc69473'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.
This is the community wiki page for the gene ''rbm43l'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.


=nomenclature changes=
=nomenclature changes=
Line 20: Line 20:
=orthology=
=orthology=


DIOPT/EggNog matches this protein ( omitting teh long string of EEEEEs)  matching >600 proteins from >200 species including reptiles and mammals.  matches to Mouse
DIOPT/EggNog matches this protein ( omitting the long string of EEEEEs)  matching >600 proteins from >200 species including reptiles and mammals.  
and rat, below,  show that this is likely a histone but the gene symbol to use here is unclear:  
   
Matches to Mouseand rat, below,  show that this is likely a 'histone 1 ' but the gene symbol to be use here is unclear:  


Mus musculus 12 seqs 10090.ENSMUSP00000037304, 10090.ENSMUSP00000101453, 10090.ENSMUSP00000044395, 10090.ENSMUSP00000036951, 10090.ENSMUSP00000057308, 10090.ENSMUSP00000137309, 10090.ENSMUSP00000128451, 10090.ENSMUSP00000060761, 10090.ENSMUSP00000079356, 10090.ENSMUSP00000099828, 10090.ENSMUSP00000062030, 10090.ENSMUSP00000045816 Hist1h1t, Hp1bp3, Hist1h1d, H1foo, Hist1h1e, H1f0, Gm6970, H1fx, Hist1h1b, Rbm43, Hist1h1a, Hist1h1c
Mus musculus 12 seqs 10090.ENSMUSP00000037304, 10090.ENSMUSP00000101453, 10090.ENSMUSP00000044395, 10090.ENSMUSP00000036951, 10090.ENSMUSP00000057308, 10090.ENSMUSP00000137309, 10090.ENSMUSP00000128451, 10090.ENSMUSP00000060761, 10090.ENSMUSP00000079356, 10090.ENSMUSP00000099828, 10090.ENSMUSP00000062030, 10090.ENSMUSP00000045816 Hist1h1t, Hp1bp3, Hist1h1d, H1foo, Hist1h1e, H1f0, Gm6970, H1fx, Hist1h1b, Rbm43, Hist1h1a, Hist1h1c
Line 29: Line 30:




Gene name wise, we might goin with 'rbm43-like' for now for simplicity.
Gene name/symbol wise, we might goin with 'rbm43-like' for now for simplicity. Further Ana;lsyis would be necessary to name more precisely.

Latest revision as of 14:40, 26 April 2023

rbm43l

This is the community wiki page for the gene rbm43l please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.

nomenclature changes

26APRIL2023 gene symbol changed from mgc69473 to rbm43-like to reflect provisional orthology group.

protein

uncharacterized protein LOC407914 [Xenopus tropicalis]

NCBI Reference Sequence: NP_001001233.1


>NP_001001233.1 uncharacterized protein LOC407914 [Xenopus tropicalis] MALELEENLHSEEEEEEDEEEEEEEEEEEEEEEEEEEEEGGGMQTRSPSKRNKGGASSSSSSSGSAKKKK KKKNQPGRYSQLVVDTIRKLGERNGSSLAKIYSEAKKVAWFDQQNGRTYLKYSIKALVQNDTLLQVKGVG ANGSFRLNKKKLEGLPFEKKAAPPAKPPSKRRAPAASSSPAKSHKKAKPTAEKEKPQKSSVKAPSKSHKK GAKGKKVKKGAKPSVPKVPKSKKA

orthology

DIOPT/EggNog matches this protein ( omitting the long string of EEEEEs) matching >600 proteins from >200 species including reptiles and mammals.

Matches to Mouseand rat, below, show that this is likely a 'histone 1 ' but the gene symbol to be use here is unclear:

Mus musculus 12 seqs 10090.ENSMUSP00000037304, 10090.ENSMUSP00000101453, 10090.ENSMUSP00000044395, 10090.ENSMUSP00000036951, 10090.ENSMUSP00000057308, 10090.ENSMUSP00000137309, 10090.ENSMUSP00000128451, 10090.ENSMUSP00000060761, 10090.ENSMUSP00000079356, 10090.ENSMUSP00000099828, 10090.ENSMUSP00000062030, 10090.ENSMUSP00000045816 Hist1h1t, Hp1bp3, Hist1h1d, H1foo, Hist1h1e, H1f0, Gm6970, H1fx, Hist1h1b, Rbm43, Hist1h1a, Hist1h1c


Rattus norvegicus 9 seqs 10116.ENSRNOP00000019696, 10116.ENSRNOP00000065338, 10116.ENSRNOP00000023054, 10116.ENSRNOP00000006172, 10116.ENSRNOP00000048205, 10116.ENSRNOP00000032882, 10116.ENSRNOP00000066786, 10116.ENSRNOP00000024304, 10116.ENSRNOP00000053053 Hp1bp3, LOC684828, Hist1h1a, Rbm43, H1foo, H1fx, Hist1h1d, Hist1h1b, H1f0


Gene name/symbol wise, we might goin with 'rbm43-like' for now for simplicity. Further Ana;lsyis would be necessary to name more precisely.