XB-FEAT-29098238

From XenWiki
Jump to navigation Jump to search

cxc17

This the Xenbase wiki page for the Xenopus cxc17 genes. Please feel free to record here, any information relevent to cxc17 that is not recorded elswhere on Xenbase.

nomenclature updates

27MAR2026

The gene name and gene symbol of the these Xenopus genes have been updated, changing from LOC116412198, uncharacterized LOC116412198 to cxc17, C-X-C motif chemokine ligand 17, following a published study which identified on mutilple amphibian cxc17 orthologs.

See: Yu J, Li HZ, Wang JJ, Yao JJ, Hu WF, Liu YL, Guo ZY. Identification and functional characterization of CXCL17 orthologs in amphibians. Arch Biochem Biophys. 2026 Mar 18;780:110797. doi: 10.1016/j.abb.2026.110797. Epub ahead of print. PMID: 41861938.


These are the 2 Xenopus genes identified in the above study:


Xenopus laevis. cxc17.L (African clawed frog). Genbank ID: OCT73022

Protein name: XELAEV_18036001mg

protein sequence

MRTVAAFIFLAAITLCHCWTPESQDSAGRTDEDRSLPKRSVRKDALGSPNRPERHHLKCCERLRPQHPQRKRRHMKAPRAQSIHHRRRCNTLCRGKKPPKVMVSLPLS


Xenopus tropicalis cxc17 (tropical clawed frog) Gene ID: 116412198

mRNA ID: XM_031905867

Protein ID: XP_031761727

Protein sequence

MRTVAVFMFLAAITLCYCWTPQRQDSSGRTNENRGLAKRNGHKDALGSPLRPERHHLRCCERLSPQHPQRKRRHMRAPRAHPIHQRRRCTTNCRGKKPSKFMVPLPLS