XB-FEAT-22164552: Difference between revisions

From XenWiki
Jump to navigation Jump to search
(Created page with " =''csta''= This is the community wiki page for the gene ''csta'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere...")
 
 
(2 intermediate revisions by the same user not shown)
Line 1: Line 1:


=''csta''=
=''cstb''=
This is the community wiki page for the gene ''csta'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.
This is the community wiki page for the gene ''cstb'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.


=protein sequence=
NCBI Reference Sequence: XP_018104492.1 cystatin-B [Xenopus laevis]


=protein sequence=
MEGICGGTGAQKVADAEVQEICDKVKAEFLEKSGVNTSLFKAVSYKTQQVAGTNYFIKVNIGDDKCVHIRVYRIVGEQMEALRFDSFLLD
MEGICGGTGAQKVADAEVQEICDKVKAEFLEKSGVNTSLFKAVSYKTQQVAGTNYFIKVNIGDDKCVHIRVYRIVGEQMEALRFDSFLLD
KTMEEEIVYF
KTMEEEIVYF
Line 11: Line 12:
this protein has a Cystatin-like domain, and is predicted to have cysteine-type endopeptidase inhibitor activity.  
this protein has a Cystatin-like domain, and is predicted to have cysteine-type endopeptidase inhibitor activity.  


The DIOPT EggNogg tool groups it with CSTA CSTB and STFA2 gene from Mouse, Rat and 120 other species, and cst14a.1, zgc:153129, zgc:56530 in Danio Rerio (Zebrafish). This is good eveidence it is a cystantin, but cannot tell if it shoudl be  cystatin A or cystatin B  
The DIOPT EggNogg tool groups it with CSTA CSTB and STFA2 gene from Mouse, Rat and 120 other species, and cst14a.1, zgc:153129, zgc:56530 in Danio Rerio (Zebrafish). This is good eveidence it is a cystantin, and we will stick with teh NCBI ref seq name of ''cystatin B'' ( without the hyphen)


=nomenclature changes=
=nomenclature changes=


based on above quick analysis, this gene is provisonaly renamed ''cystain A'', with gene symbol ''csta''
based on above quick analysis, this gene is provisonaly renamed ''cystain B'', with gene symbol ''cstb''

Latest revision as of 14:19, 4 January 2023

cstb

This is the community wiki page for the gene cstb please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.

protein sequence

NCBI Reference Sequence: XP_018104492.1 cystatin-B [Xenopus laevis]

MEGICGGTGAQKVADAEVQEICDKVKAEFLEKSGVNTSLFKAVSYKTQQVAGTNYFIKVNIGDDKCVHIRVYRIVGEQMEALRFDSFLLD KTMEEEIVYF


this protein has a Cystatin-like domain, and is predicted to have cysteine-type endopeptidase inhibitor activity.

The DIOPT EggNogg tool groups it with CSTA CSTB and STFA2 gene from Mouse, Rat and 120 other species, and cst14a.1, zgc:153129, zgc:56530 in Danio Rerio (Zebrafish). This is good eveidence it is a cystantin, and we will stick with teh NCBI ref seq name of cystatin B ( without the hyphen)

nomenclature changes

based on above quick analysis, this gene is provisonaly renamed cystain B, with gene symbol cstb