XB-FEAT-22164552

From XenWiki
Jump to navigation Jump to search

cstb

This is the community wiki page for the gene cstb please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.

protein sequence

NCBI Reference Sequence: XP_018104492.1 cystatin-B [Xenopus laevis]

MEGICGGTGAQKVADAEVQEICDKVKAEFLEKSGVNTSLFKAVSYKTQQVAGTNYFIKVNIGDDKCVHIRVYRIVGEQMEALRFDSFLLD KTMEEEIVYF


this protein has a Cystatin-like domain, and is predicted to have cysteine-type endopeptidase inhibitor activity.

The DIOPT EggNogg tool groups it with CSTA CSTB and STFA2 gene from Mouse, Rat and 120 other species, and cst14a.1, zgc:153129, zgc:56530 in Danio Rerio (Zebrafish). This is good eveidence it is a cystantin, and we will stick with teh NCBI ref seq name of cystatin B ( without the hyphen)

nomenclature changes

based on above quick analysis, this gene is provisonaly renamed cystain B, with gene symbol cstb