XB-FEAT-990243: Difference between revisions
(One intermediate revision by the same user not shown) | |||
Line 1: | Line 1: | ||
= | =''pde9a''= | ||
This is the community wiki page for the gene '' | This is the community wiki page for the gene ''pde9a'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase. | ||
=orthology= | |||
25APRIL2023 | |||
this gene was previously unnamed. | |||
Assessment by Xenbase using DIOPT/EggNogg tool matches the Xtrop protein to the PDE/phosphodiesterase group with homology groups with high confidence- matching ~3000 proteins from ~300 species, including many proteins/genes in mammals, reptiles, birds/chicken and fish. | |||
We will provisionally rename based on the current Uniprot protein symbol, 'pde9a' . and the human gene name for PDE9A, ie phosphodiesterase 9A. | |||
=nomenclature change= | |||
25APRIL2023 | |||
Xenopus gene symbol/name changed from Putative ortholog of cGMP-specific 3',5'-cyclic phosphodiesterase 9A XB990243 to pde9a, phosphodiesterase 9A | |||
=protein= | =protein= |
Latest revision as of 08:04, 26 April 2023
pde9a
This is the community wiki page for the gene pde9a please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.
orthology
25APRIL2023
this gene was previously unnamed.
Assessment by Xenbase using DIOPT/EggNogg tool matches the Xtrop protein to the PDE/phosphodiesterase group with homology groups with high confidence- matching ~3000 proteins from ~300 species, including many proteins/genes in mammals, reptiles, birds/chicken and fish.
We will provisionally rename based on the current Uniprot protein symbol, 'pde9a' . and the human gene name for PDE9A, ie phosphodiesterase 9A.
nomenclature change
25APRIL2023
Xenopus gene symbol/name changed from Putative ortholog of cGMP-specific 3',5'-cyclic phosphodiesterase 9A XB990243 to pde9a, phosphodiesterase 9A
protein
high affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A [Xenopus tropicalis]
NCBI Reference Sequence: XP_012822440.1
>XP_012822440.1 high affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A [Xenopus tropicalis]
MGSGASAHGQKTIYLDVDGKIQKVVFSQHSSPAEIKELLCASAGLPWQAAIILLDKKGTVVATDSTIPKN
SKSSAYRIVSRSISPRPEKEDFFQNILSQVTEEFSRAFRVTEMKREVMERLAMLERRMEVEGLKAIDIDK
CKNELKNLRDEMEKKTSRLSCPCRFYYSEDIKKLNPRRDVPTYPKYTLSSETIDALKKPTFDVWHWEYNE
MLSCLEFMYHDLGLVREFNMNPITLKRWLLCIQENYRTNPFHNFRHCFCVTQMMYGMIHLCNLQEKMSLI
ELGVLMTSAVCHDLDHPGYNNTYQINAHTELAIRYNDMSPLENHHCAVAFQILAQPENNIFANITPELFK
QIRQSIIRLILATDMARHGEILESFKKVLPNFDFSNEDHVKTLQMVLIKCCDISNEVRPTKVAEPWVDCL
LEEYFMQSDREKSEGLPVTPFMDRDKVTKPKAQIGFIKFVLIPMFESVMKLFPHIEEVMVLPLREARDHY
EELMEIEEALAEVQQKKSATLSIGGKLQVSA