XB-FEAT-990243: Difference between revisions
| (3 intermediate revisions by 2 users not shown) | |||
| Line 1: | Line 1: | ||
= | =''pde9al''= | ||
This is the community wiki page for the gene '' | This is the community wiki page for the gene ''pde9al'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase. | ||
=orthology= | |||
25APRIL2023 | |||
this gene was previously unnamed. | |||
Assessment by Xenbase using DIOPT/EggNogg tool matches the Xtrop protein to the PDE/phosphodiesterase group with homology groups with high confidence- matching ~3000 proteins from ~300 species, including many proteins/genes in mammals, reptiles, birds/chicken and fish. | |||
We will provisionally rename based on the current Uniprot protein symbol, 'pde9a' . and the human gene name for PDE9A, ie phosphodiesterase 9A. | |||
=nomenclature change= | |||
25APRIL2023 | |||
Xenopus gene symbol/name changed from Putative ortholog of cGMP-specific 3',5'-cyclic phosphodiesterase 9A XB990243 to pde9a, phosphodiesterase 9A | |||
03/03/2025 | |||
based on synteny patterns, the ''pde9a'' genes on chr 2 are supported as the true orthologs of PDE9A, so these chr 7 genes have been renamed ''pde9al''. | |||
=protein= | =protein= | ||
Latest revision as of 20:27, 3 March 2025
pde9al
This is the community wiki page for the gene pde9al please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.
orthology
25APRIL2023
this gene was previously unnamed.
Assessment by Xenbase using DIOPT/EggNogg tool matches the Xtrop protein to the PDE/phosphodiesterase group with homology groups with high confidence- matching ~3000 proteins from ~300 species, including many proteins/genes in mammals, reptiles, birds/chicken and fish.
We will provisionally rename based on the current Uniprot protein symbol, 'pde9a' . and the human gene name for PDE9A, ie phosphodiesterase 9A.
nomenclature change
25APRIL2023
Xenopus gene symbol/name changed from Putative ortholog of cGMP-specific 3',5'-cyclic phosphodiesterase 9A XB990243 to pde9a, phosphodiesterase 9A
03/03/2025
based on synteny patterns, the pde9a genes on chr 2 are supported as the true orthologs of PDE9A, so these chr 7 genes have been renamed pde9al.
protein
high affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A [Xenopus tropicalis]
NCBI Reference Sequence: XP_012822440.1
>XP_012822440.1 high affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A [Xenopus tropicalis]
MGSGASAHGQKTIYLDVDGKIQKVVFSQHSSPAEIKELLCASAGLPWQAAIILLDKKGTVVATDSTIPKN
SKSSAYRIVSRSISPRPEKEDFFQNILSQVTEEFSRAFRVTEMKREVMERLAMLERRMEVEGLKAIDIDK
CKNELKNLRDEMEKKTSRLSCPCRFYYSEDIKKLNPRRDVPTYPKYTLSSETIDALKKPTFDVWHWEYNE
MLSCLEFMYHDLGLVREFNMNPITLKRWLLCIQENYRTNPFHNFRHCFCVTQMMYGMIHLCNLQEKMSLI
ELGVLMTSAVCHDLDHPGYNNTYQINAHTELAIRYNDMSPLENHHCAVAFQILAQPENNIFANITPELFK
QIRQSIIRLILATDMARHGEILESFKKVLPNFDFSNEDHVKTLQMVLIKCCDISNEVRPTKVAEPWVDCL
LEEYFMQSDREKSEGLPVTPFMDRDKVTKPKAQIGFIKFVLIPMFESVMKLFPHIEEVMVLPLREARDHY
EELMEIEEALAEVQQKKSATLSIGGKLQVSA