All public logs
Jump to navigation
Jump to search
Combined display of all available logs of XenWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).
- 12:30, 11 August 2023 VG talk contribs created page File:Blastopore closure-neural plate formation.mov
- 12:30, 11 August 2023 VG talk contribs uploaded File:Blastopore closure-neural plate formation.mov
- 12:28, 11 August 2023 VG talk contribs created page File:Blastopore closure-neural plate formation.png
- 12:28, 11 August 2023 VG talk contribs uploaded File:Blastopore closure-neural plate formation.png
- 11:42, 11 August 2023 VG talk contribs created page File:3 chambered heart.mp4
- 11:42, 11 August 2023 VG talk contribs uploaded File:3 chambered heart.mp4
- 11:02, 11 August 2023 VG talk contribs created page File:3 chambered heart.png
- 11:02, 11 August 2023 VG talk contribs uploaded File:3 chambered heart.png
- 13:47, 26 July 2023 Christina talk contribs created page XB-FEAT-29208211 (Created page with "=''il17a.2''= =nomenclature changes= 27JULY2023 Three genes were annotated in the v10 assembly as ''il17a-like'' on the same section of Chromosome 5L. These have been provis...")
- 13:38, 26 July 2023 Christina talk contribs created page XB-FEAT-29208203 (Created page with "=''il17a''= =nomenclature changes= Three genes were annotated in the v10 assembly as ''il17a-like'' on the same section of Chromosome 5L. These have been provisionally given...")
- 13:20, 26 July 2023 Christina talk contribs created page XB-FEAT-29208219 (Created page with "=''il17a.3''= =nomenclature changes= Three''il17a'' genes were annotated as ''il17a-like'' omn Chromosome 5L/5S. in the ''X. laevis'' v10.1 annotation. These genes are now p...")
- 10:44, 14 July 2023 Christina talk contribs created page XB-FEAT-29079666 (Created page with "=''btnl10'' = This is the community wiki page for the gene ''btnl10'' please feel free to add any information that is relevant to this gene that is not already captured else...")
- 08:42, 14 July 2023 Christina talk contribs created page XB-FEAT-29081262 (Created page with "=''ctss.4''= This is the community wiki page for the ''Xenopus ctss.4'' genes. Please feel free to add any information here, that is relevant to these genes and is not already...")
- 08:23, 14 July 2023 Christina talk contribs created page XB-FEAT-29089970 (Created page with "=''pkn2l.8''= This is the community wiki page for the ''Xenopus pkn2l.8'' genes. Please feel free to add any information here, that is relevant to these genes and is not alrea...")
- 07:57, 14 July 2023 Christina talk contribs created page XB-FEAT-29087614 (Created page with "=''pkn2l.7''= This is the community wiki page for the ''Xenopus pkn2l.7'' genes. Please feel free to add any information here, that is relevant to these genes and is not alre...")
- 07:34, 14 July 2023 Christina talk contribs created page XB-FEAT-29091126 (Created page with " = ''stk38l2'' = This is the community wiki page for the ''Xenopus stk38l2'' genes. Please feel free to add any information here, that is relevant to these genes and is not al...")
- 07:20, 14 July 2023 Christina talk contribs created page XB-FEAT-29089974 (Created page with " =''pkn2l.6''= This is the community wiki page for the ''Xenopus pkn2l.6'' genes. Please feel free to add any information here, that is relevant to these genes and is not alre...")
- 07:06, 14 July 2023 Christina talk contribs created page XB-FEAT-29089902 (Created page with "=''akt1l''= This is the community wiki page for the ''Xenopus'' ''akt1l'' genes. Please feel free to add any information here, that is relevant to these genes and is not alrea...")
- 15:23, 13 July 2023 Christina talk contribs created page XB-FEAT-29079534 (Created page with "=''pkn2l.5''= This is the community wiki page for the ''Xenopus pkn2l.5'' genes. Please feel free to add any information here, that is relevant to these genes and is not alrea...")
- 15:16, 13 July 2023 Christina talk contribs created page XB-FEAT-29089978 (Created page with "=''pkn2l.4''= This is the community wiki page for the Xenopus pkn2l.4 genes. Please feel free to add any information here, that is relevant to these genes and is not already c...")
- 15:10, 13 July 2023 Christina talk contribs created page XB-FEAT-29092170 (Created page with "= '' pkn1l.2'' = This is the community wiki page for the '' Xenopus '' ''pkn1l.2'' genes. Please feel free to add any information here, that is relevant to these genes and...")
- 15:06, 13 July 2023 Christina talk contribs created page XB-FEAT-29091846 (Created page with "= '' pkn1l'' = This is the community wiki page for the '' Xenopus '' ''pkn1l '' genes. Please feel free to add any information here, that is relevant to these genes and is...")
- 14:54, 13 July 2023 Christina talk contribs created page XB-FEAT-29079470 (Created page with "=''pkn2l.3''= This is the community wiki page for the ''Xenopus'' ''pkn2l.3'' genes. Please feel free to add any information here, that is relevant to these genes and is not a...")
- 14:49, 13 July 2023 Christina talk contribs created page XB-FEAT-29091842 (Created page with "= ''pnk2l.2'' = This is the community wiki page for the '' Xenopus' '' ''pnk2l.2'' genes. Please feel free to add any information here, that is relevant to these genes and...")
- 14:38, 13 July 2023 Christina talk contribs created page XB-FEAT-29085518 (Created page with "= pkn2l = This is the community wiki page for the '' Xenopus '' ''pkn2l '' genes. Please feel free to add any information here, that is relevant to these genes and is not al...")
- 14:28, 13 July 2023 Christina talk contribs created page XB-FEAT-29089986 (Created page with "= '' ctss.3'' = This is the community wiki page for the '' Xenopus '' ''ctss.3'' genes. Please feel free to add any information here, that is relevant to these genes and is...")
- 14:14, 13 July 2023 Christina talk contribs created page XB-FEAT-29098998 (Created page with " =protein sequence= XB used this protein accession to characterize this gene: >NP_001076821.2 uncharacterized protein LOC594890 precursor [Xenopus tropicalis] MGFYRQCLIGLFALL...")
- 13:55, 13 July 2023 Christina talk contribs created page XB-FEAT-29098938 (Created page with " =gene nomenclature updates= 13 JULY 2023 ''Xenopus'' gene symbol changed from ''LOC448216'' to ''ctsk.2'' ''Xenopus'' gene from ''cathepsin K (pycnodysostosis)'' to ''cath...")
- 13:42, 13 July 2023 Christina talk contribs created page XB-FEAT-29098762 (Created page with "=''rps6ka4l''= This is the community wiki page for the '' Xenopus '' ''rps6ka4l '' genes. Please feel free to add any information here, that is relevant to these genes but t...")
- 13:22, 13 July 2023 Christina talk contribs created page XB-FEAT-29098926 (Created page with "=''ccnb5''= =nomenclature updates= 05JULY 2023 ''Xenopus'' gene symbol changed from ''LOC394448'' to ''ccnb5''. This change is supported by DIOPT/EggNog analaysis, which m...")
- 14:58, 11 July 2023 Xenbase talk contribs changed group membership for VG from (none) to administrator, interface administrator and bureaucrat
- 09:32, 6 July 2023 User account VG talk contribs was created by Xenbase talk contribs and password was sent by email
- 11:10, 21 June 2023 Christina talk contribs created page XB-FEAT-29087790 (Created page with "=RefSeq protein accession= >XP_031760301.1 gastrula zinc finger protein XlCGF26.1-like [Xenopus tropicalis] MRFCSTQNLLIHQRIHTGRSFVCSKCGKYFSHRKILIAHKWVHTGRKPFTCTESNKGFLWNRDLQQH...")
- 11:00, 21 June 2023 Christina talk contribs created page XB-FEAT-29077586 (Created page with "=refSeq protein accession= XP_031760308.1 gastrula zinc finger protein XlCGF57.1-like isoform X1 [Xenopus tropicalis] MEINPVMTTVLQTNNNTMSGPTPVTSEVPIESPKTNQLSKGQRPGKPFVCAKCKRRF...")
- 10:55, 21 June 2023 Christina talk contribs created page XB-FEAT-29097482 (Created page with "=''znf33bl''= This is the community wiki page for ''Xenopus'' ''znf33bl'' genes. Please record here any relenat information that is not captured elsewhere on Xenbase. =nomenc...")
- 10:38, 21 June 2023 Christina talk contribs created page XB-FEAT-29099066 (Created page with "=''znf24l ''= This is the Xenbase wiki page for ''Xenopus '' ''znf24l'' genes. Please record here any relevant information about ''znf24l'' not captured elsewhere on Xenbase....")
- 10:26, 21 June 2023 Christina talk contribs created page XB-FEAT-29091390 (Created page with "== =nomenclature changes= 20JUNE2023 ''Xenopus'' gene name changed from ''gastrula zinc finger protein XlCGF8.2DB-like'' to ''zinc finger and SCAN domain containing 32 like''...")
- 16:44, 16 June 2023 Christina talk contribs created page XB-FEAT-22063241 (Created page with "=nomenclature changes= 18JUNE2023 Gene name and symbol was updated from ''XB22063241 provisional ortholog of lymphocyte antigen 6 complex, locus A2'' to ''ly6g6e , lymphocyte...")
- 08:11, 16 June 2023 Christina talk contribs created page XB-FEAT-29093310 (Created page with "=''or5as1''= This is the community wiki page for the ''Xenopus'' ''or5as1'' genes. Please feel free to record here anything relevant to this gene that is not recorded elsewher...")
- 11:14, 15 June 2023 Christina talk contribs created page XB-FEAT-29077890 (Created page with "=cupin1.2= There's a complex evolutionary history of a set of genes including those previously called '''DYNAP''' in the region between C18orf54 and RAB27b. After review fro...")
- 14:45, 8 June 2023 Christina talk contribs created page XB-FEAT-22068128 (Created page with "=''spmip4''= his is the community wiki page for the gene ''spmip4'' please feel free to add any information that is relevant to this gene that is not already captured elsewher...")
- 13:05, 8 June 2023 Christina talk contribs created page XB-FEAT-29071333 (Created page with "=''atrx2''=")
- 10:07, 8 June 2023 Christina talk contribs created page XB-FEAT-22065335 (Created page with "=''msantdl.2 ''= This is the community wiki page for the gene ''msantdl.2 '' please feel free to add any information that is relevant to this gene that is not already capture...")
- 11:56, 7 June 2023 Christina talk contribs created page XB-FEAT-22068619 (Created page with "=''XB22068619 ''= This is the community wiki page for the gene ''XB22068619 '' please feel free to add any information that is relevant to this gene that is not already captu...")
- 11:31, 7 June 2023 Christina talk contribs created page XB-FEAT-25874688 (Created page with "=''trat1l''= This is the community wiki page for the gene ''trat1l'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 11:14, 7 June 2023 Christina talk contribs created page XB-FEAT-22069556 (Created page with "=nomenclature updates= 05 JUNE 2023 ''Xenopus'' gene symbol and gene name has changed for genepage ID: 22069550 From ''mettl7a.3, methyltransferase like 7A, gene 3'' to ''tm...")
- 08:30, 7 June 2023 Christina talk contribs created page XB-FEAT-6464249 (Created page with "=''tektl1''= This is the community wiki page for the gene ''tektl1'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe...")
- 12:53, 6 June 2023 Christina talk contribs created page XB-FEAT-6469233 (Created page with "=nomenclature updates= 05JUNE 2023 Human name has changed for Entrez Gene: 10086. From HERV-H LTR-associating 1 to HHLA1 neighbor of OC90")
- 11:56, 6 June 2023 Christina talk contribs created page XB-FEAT-22065730 (Created page with "=''ocm4.10''= This is the community wiki page for the gene ''ocm4.10'' please feel free to add any information that is relevant to this gene that is not already captured elsew...")
- 11:54, 6 June 2023 Christina talk contribs created page XB-FEAT-22065778 (Created page with "=''ocm4.9''= This is the community wiki page for the gene ''ocm4.9'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe...")