User contributions for Xenbase
Jump to navigation
Jump to search
8 January 2024
- 07:1207:12, 8 January 2024 diff hist +200 XB-FEAT-954189 →fibrillin genes in representative non-Mammalian eukaryotes
- 07:1107:11, 8 January 2024 diff hist +4,875 XB-FEAT-954189 →fbn1
- 06:0306:03, 8 January 2024 diff hist +9 N XB-FEAT-22041699 Created page with "=fim-a.1="
3 January 2024
- 14:4414:44, 3 January 2024 diff hist +466 N File:Figure 003.png pattypan 22.03 current
- 14:4414:44, 3 January 2024 diff hist +465 N File:Figure 002.png pattypan 22.03 current
- 14:4314:43, 3 January 2024 diff hist +470 N File:Figure 001.png pattypan 22.03 current
- 14:4314:43, 3 January 2024 diff hist +468 N File:Different terminology for disease terms on pages.jpg pattypan 22.03 current
- 07:3007:30, 3 January 2024 diff hist +2 XB-FEAT-29209255 →nfil3l.2 current
- 07:3007:30, 3 January 2024 diff hist +1,043 N XB-FEAT-29209255 Created page with "=nfil3l.2= This is the Xenbase wiki page for the ''Xenopus nfil3l.2'' genes. Please feel free to record here any information about these genes that is not captured elsewhere on Xenbase. =nomenclature changes= 01JAN2024 The ''Xenopus laevis nfil3l.2.L'', nuclear factor interleukin 3 regulated like gene 2 [NCBI GeneID: 447503] is on Chr4L, [v10 gene model: XBXL10_1g19722] and has been placed here on its own gene page. We can not find any paralogous ''nfil3l.2'' gene..."
2 January 2024
- 08:2708:27, 2 January 2024 diff hist +554 XB-FEAT-988305 →prpf4b current
- 08:1608:16, 2 January 2024 diff hist +310 XB-FEAT-493297 →prpf4 current
18 December 2023
- 11:3111:31, 18 December 2023 diff hist −10 XB-FEAT-5886445 →c10h17orf80 current
- 11:3011:30, 18 December 2023 diff hist +164 XB-FEAT-5886445 →nomenclature changes
14 December 2023
- 12:5712:57, 14 December 2023 diff hist +4 XB-FEAT-22164454 →tff3.5
- 12:5712:57, 14 December 2023 diff hist +399 N XB-FEAT-22164454 Created page with "=tff3.5= This is the Xenbase community wiki page for ''Xenopus ''tff3.5'' genes. Please feel free to record here any relevant information about these ones, that is not already represented on the gene page or elsewhere on Xenbase. =genome annotation notes= 12DEC2023 note that ''tff3.5.S'' is not annoatated on the ''X. laevis'' v10 genome release. We looked, and couldn't find a v10.1 model for it."
11 December 2023
- 10:1910:19, 11 December 2023 diff hist +139 XB-FEAT-29084766 →protein current
- 09:5109:51, 11 December 2023 diff hist +35 XB-FEAT-29084766 →synteny
- 09:4909:49, 11 December 2023 diff hist +289 XB-FEAT-29084766 →homology group analysis via EggNOGG v5
- 09:4809:48, 11 December 2023 diff hist −270 XB-FEAT-29084766 →nomenclature changes
- 09:4809:48, 11 December 2023 diff hist +57 XB-FEAT-29084766 →homology group analysis via EggNOGG v5
- 09:2509:25, 11 December 2023 diff hist 0 XB-FEAT-29084766 →synteny
- 09:2409:24, 11 December 2023 diff hist +501 XB-FEAT-29084766 →homology group analysis via EggNOGG v5
- 09:2409:24, 11 December 2023 diff hist −8 XB-FEAT-29084766 →synteny
- 09:2109:21, 11 December 2023 diff hist +2,020 N XB-FEAT-29084766 Created page with " =protein= uncharacterized protein '''LOC101730711''' [Xenopus tropicalis] NCBI Reference Sequence: XP_017952313.2 >XP_017952313.2 uncharacterized protein LOC101730711 [Xenopus tropicalis] MCHILIFILLFLFLFQRKICEGRGRLSCPAVMGPARLHPFIILLGLFHLFLSSTSAVKVENFTLFEEKLK LEAHTANMIPCVFHTRRRLNPLRVQLEWGKMDKEGYVPLIHLDGNHVRKAAADFGDKYQLFIPQVSQGNC SLVINPMDIADSGTYQVRLRILGKLYEPVPSIEIQVVDQRKVESRAWGKKKTTVPPTTIATVPPGFVDDV QKRLVKIDKMAIIAIILNGVFVGIAILLGVLVFITYRKKSSSGDEENPPKKRKQKGKKEPSDESEESSSS..."
5 December 2023
- 14:2514:25, 5 December 2023 diff hist +1 XB-FEAT-483692 →pax8
- 09:3409:34, 5 December 2023 diff hist +14 N XB-FEAT-22169226 Created page with "=''chst9l.2''=" current
- 09:3309:33, 5 December 2023 diff hist −6 XB-FEAT-967555 →chst9l.2 current
- 09:3309:33, 5 December 2023 diff hist +10 XB-FEAT-967555 →chst7
4 December 2023
- 13:5413:54, 4 December 2023 diff hist −6 XB-FEAT-483692 No edit summary Tag: Manual revert
- 13:5313:53, 4 December 2023 diff hist +6 XB-FEAT-483692 No edit summary Tag: Reverted
- 12:4612:46, 4 December 2023 diff hist +1,388 N XB-FEAT-29078026 Created page with "=''chst1l''= =protein > homology group> nomenclature notes= 12.04.2023 protein: carbohydrate sulfotransferase 1 [Xenopus laevis] NCBI Reference Sequence: XP_018107451.1 >XP_018107451.1 carbohydrate sulfotransferase 1 [Xenopus laevis] MECSWKAVVLLVFASLGIQYTAIKSLRTAFKSPCQVMGGESRCFQRDLRDNASRLLCEDLGQVNRKHIIL LATTRSGSSFLGQIFNQNPDIFYLYEPLYHVQRAFTNSSTRMQKQIDRRSLLGAYRDLLHNLYNCDFYFL ENYLRPAPKDHETTSFFRRGASNALCLPPVCEQLHPIEEHLCSKKCRTVNLTLVSKSCHQYKHMAIKTVR IPEINDIRTLVEDPRLNLKVIH..." current
- 12:0112:01, 4 December 2023 diff hist +312 XB-FEAT-960884 →chst6 current
30 November 2023
- 07:2607:26, 30 November 2023 diff hist +3 XB-FEAT-1000743 →synteny map
- 07:2507:25, 30 November 2023 diff hist +179 XB-FEAT-1000743 →synteny map
- 07:2007:20, 30 November 2023 diff hist +813 XB-FEAT-1000743 →synteny map
- 07:2007:20, 30 November 2023 diff hist +815 XB-FEAT-483145 →synteny current
- 06:5106:51, 30 November 2023 diff hist +12 XB-FEAT-1000743 No edit summary
- 06:4906:49, 30 November 2023 diff hist −51 XB-FEAT-1000743 →synteny map
- 06:4606:46, 30 November 2023 diff hist +978 N File:Six6 synteny.png No edit summary current
- 06:4306:43, 30 November 2023 diff hist +751 XB-FEAT-1000743 →nomenclature changes
29 November 2023
- 13:2213:22, 29 November 2023 diff hist −1 XB-FEAT-483145 →six6
- 13:2113:21, 29 November 2023 diff hist +19 XB-FEAT-483145 →synteny
- 13:1613:16, 29 November 2023 diff hist +169 XB-FEAT-483145 →synteny
- 13:1113:11, 29 November 2023 diff hist +132 XB-FEAT-483145 →six6
- 09:1209:12, 29 November 2023 diff hist +1,135 XB-FEAT-6257418 No edit summary current
- 07:1407:14, 29 November 2023 diff hist −385 XB-FEAT-22065720 →Summary from NCBI current
- 07:1307:13, 29 November 2023 diff hist +503 XB-FEAT-22065720 →nomenclature notes
- 07:0907:09, 29 November 2023 diff hist −1 XB-FEAT-22065720 →nomenclature notes
- 07:0907:09, 29 November 2023 diff hist −2 XB-FEAT-22065720 →nomenclature notes
20 November 2023
- 09:5509:55, 20 November 2023 diff hist +995 XB-FEAT-992773 No edit summary current