All public logs

Combined display of all available logs of XenWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).

• 10:32, 31 January 2024 VG talk contribs uploaded File:20240131 from stem cells to human development - slider.png
• 09:30, 29 January 2024 VG talk contribs created page File:20240129 sdb website image collection - slider.png
• 09:30, 29 January 2024 VG talk contribs uploaded File:20240129 sdb website image collection - slider.png
• 11:41, 24 January 2024 ABell talk contribs created page XB-FEAT-29099062 (Created page with "=''naip.3''= This is the community wiki page for the gene ''naip.3'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase =nomenclature= 24JAN2024 The following synteny was used to determine new gene names for the ''naip'' genes in ''Xenopus tropicalis'' and ''Xenopus laevis''. There are only L subgenome orthologs of the ''naip'' genes in ''X. laevis''. '''''X. tropicalis''''' - ''olcn''> ''gtf2h2...")
• 11:39, 24 January 2024 ABell talk contribs created page XB-FEAT-29091370 (Created page with "=''naip''= This is the community wiki page for the gene ''naip'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase =nomenclature= 24JAN2024 The following synteny was used to determine new gene names for the ''naip'' genes in ''Xenopus tropicalis'' and ''Xenopus laevis''. There are only L subgenome orthologs of the ''naip'' genes in ''X. laevis''. '''''X. tropicalis''''' - ''olcn''> ''gtf2h2''> '...")
• 11:52, 23 January 2024 ABell talk contribs created page XB-FEAT-29085226 (Created page with "=nlrp3l= This is the community wiki page for the gene ''nlrp3l'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase =nomenclature= 23JAN2024 Gene symbol changed from ''LOC101731251'' to ''nlrp3l'' to reflect that it is like the NLRP3 genes in humans, while we work out the specific family and member number of this particular gene in an ongoing review of NLR type genes. Also the ''X. laevis'' L subgen...")
• 15:16, 10 January 2024 VG talk contribs created page File:20240110 Pade et al - Figure 4.jpeg
• 15:16, 10 January 2024 VG talk contribs uploaded File:20240110 Pade et al - Figure 4.jpeg
• 15:15, 10 January 2024 VG talk contribs created page File:20240110 Pade et al - Figure 3.jpeg
• 15:15, 10 January 2024 VG talk contribs uploaded File:20240110 Pade et al - Figure 3.jpeg
• 15:15, 10 January 2024 VG talk contribs created page File:20240110 Pade et al - Figure 1.jpeg
• 15:15, 10 January 2024 VG talk contribs uploaded File:20240110 Pade et al - Figure 1.jpeg
• 15:15, 10 January 2024 VG talk contribs created page File:20240110 Pade et al - graphical abstract.jpeg
• 15:15, 10 January 2024 VG talk contribs uploaded File:20240110 Pade et al - graphical abstract.jpeg
• 15:14, 10 January 2024 VG talk contribs created page File:20240110 Pade et al - slider.png
• 15:14, 10 January 2024 VG talk contribs uploaded File:20240110 Pade et al - slider.png
• 13:36, 9 January 2024 VG talk contribs created page File:20240108 83rd SDB meeting - slider.png
• 13:36, 9 January 2024 VG talk contribs uploaded File:20240108 83rd SDB meeting - slider.png
• 13:36, 9 January 2024 VG talk contribs deleted page File:20240108 83rd SDB meeting - slider.png
• 13:35, 9 January 2024 VG talk contribs created page File:20240108 83rd SDB meeting - slider.png
• 13:35, 9 January 2024 VG talk contribs uploaded File:20240108 83rd SDB meeting - slider.png
• 13:34, 9 January 2024 VG talk contribs deleted page File:20240108 83rd SDB meeting - slider.png (replace with new version)
• 11:09, 8 January 2024 VG talk contribs created page File:20240108 83rd SDB meeting - slider.png
• 11:09, 8 January 2024 VG talk contribs uploaded File:20240108 83rd SDB meeting - slider.png
• 06:03, 8 January 2024 Xenbase talk contribs created page XB-FEAT-22041699 (Created page with "=fim-a.1=")
• 11:24, 4 January 2024 Xenbase talk contribs changed group membership for Christina from (none) to administrator and bureaucrat
• 11:24, 4 January 2024 Xenbase talk contribs changed group membership for Kkarimi from (none) to administrator, interface administrator, bureaucrat and suppressor
• 14:44, 3 January 2024 Xenbase talk contribs created page File:Figure 003.png (pattypan 22.03)
• 14:44, 3 January 2024 Xenbase talk contribs uploaded File:Figure 003.png (pattypan 22.03)
• 14:44, 3 January 2024 Xenbase talk contribs created page File:Figure 002.png (pattypan 22.03)
• 14:44, 3 January 2024 Xenbase talk contribs uploaded File:Figure 002.png (pattypan 22.03)
• 14:43, 3 January 2024 Xenbase talk contribs created page File:Figure 001.png (pattypan 22.03)
• 14:43, 3 January 2024 Xenbase talk contribs uploaded File:Figure 001.png (pattypan 22.03)
• 14:43, 3 January 2024 Xenbase talk contribs created page File:Different terminology for disease terms on pages.jpg (pattypan 22.03)
• 14:43, 3 January 2024 Xenbase talk contribs uploaded File:Different terminology for disease terms on pages.jpg (pattypan 22.03)
• 10:52, 3 January 2024 VG talk contribs created page File:20240103 xenbase wiki image test.png
• 10:52, 3 January 2024 VG talk contribs uploaded File:20240103 xenbase wiki image test.png
• 07:30, 3 January 2024 Xenbase talk contribs created page XB-FEAT-29209255 (Created page with "=nfil3l.2= This is the Xenbase wiki page for the ''Xenopus nfil3l.2'' genes. Please feel free to record here any information about these genes that is not captured elsewhere on Xenbase. =nomenclature changes= 01JAN2024 The ''Xenopus laevis nfil3l.2.L'', nuclear factor interleukin 3 regulated like gene 2 [NCBI GeneID: 447503] is on Chr4L, [v10 gene model: XBXL10_1g19722] and has been placed here on its own gene page. We can not find any paralogous ''nfil3l.2'' gene...")
• 19:23, 15 December 2023 Christina talk contribs created page XB-FEAT-29099462 (Created page with "=smim38= This is the community wiki page for the gene ''smim38'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase =nomenclature= 15DEC2023 The ''X. laevis'' L gene previously annotated as ''LOC121402925.L'' (Xenbase v10 gene model XBXL10_1g17811) is determined to be the L homeolog of the ''smim38'' gene, due to synteny and sequence similarity with ''X. tropicalis'' ''smim38''.")
• 12:57, 14 December 2023 Xenbase talk contribs created page XB-FEAT-22164454 (Created page with "=tff3.5= This is the Xenbase community wiki page for ''Xenopus ''tff3.5'' genes. Please feel free to record here any relevant information about these ones, that is not already represented on the gene page or elsewhere on Xenbase. =genome annotation notes= 12DEC2023 note that ''tff3.5.S'' is not annoatated on the ''X. laevis'' v10 genome release. We looked, and couldn't find a v10.1 model for it.")
• 09:21, 11 December 2023 Xenbase talk contribs created page XB-FEAT-29084766 (Created page with " =protein= uncharacterized protein '''LOC101730711''' [Xenopus tropicalis] NCBI Reference Sequence: XP_017952313.2 >XP_017952313.2 uncharacterized protein LOC101730711 [Xenopus tropicalis] MCHILIFILLFLFLFQRKICEGRGRLSCPAVMGPARLHPFIILLGLFHLFLSSTSAVKVENFTLFEEKLK LEAHTANMIPCVFHTRRRLNPLRVQLEWGKMDKEGYVPLIHLDGNHVRKAAADFGDKYQLFIPQVSQGNC SLVINPMDIADSGTYQVRLRILGKLYEPVPSIEIQVVDQRKVESRAWGKKKTTVPPTTIATVPPGFVDDV QKRLVKIDKMAIIAIILNGVFVGIAILLGVLVFITYRKKSSSGDEENPPKKRKQKGKKEPSDESEESSSS...")
• 09:34, 5 December 2023 Xenbase talk contribs created page XB-FEAT-22169226 (Created page with "=''chst9l.2''=")
• 12:46, 4 December 2023 Xenbase talk contribs created page XB-FEAT-29078026 (Created page with "=''chst1l''= =protein > homology group> nomenclature notes= 12.04.2023 protein: carbohydrate sulfotransferase 1 [Xenopus laevis] NCBI Reference Sequence: XP_018107451.1 >XP_018107451.1 carbohydrate sulfotransferase 1 [Xenopus laevis] MECSWKAVVLLVFASLGIQYTAIKSLRTAFKSPCQVMGGESRCFQRDLRDNASRLLCEDLGQVNRKHIIL LATTRSGSSFLGQIFNQNPDIFYLYEPLYHVQRAFTNSSTRMQKQIDRRSLLGAYRDLLHNLYNCDFYFL ENYLRPAPKDHETTSFFRRGASNALCLPPVCEQLHPIEEHLCSKKCRTVNLTLVSKSCHQYKHMAIKTVR IPEINDIRTLVEDPRLNLKVIH...")
• 06:46, 30 November 2023 Xenbase talk contribs created page File:Six6 synteny.png
• 06:46, 30 November 2023 Xenbase talk contribs uploaded File:Six6 synteny.png
• 13:12, 18 October 2023 Xenbase talk contribs created page File:Screenshot 2023-10-18 at 4.10.09 PM.png
• 13:12, 18 October 2023 Xenbase talk contribs uploaded File:Screenshot 2023-10-18 at 4.10.09 PM.png
• 12:38, 18 October 2023 Xenbase talk contribs created page XB-FEAT-18034121 (Created page with "=''rho.2''= This is the community wiki page for the ''Xenopus rho.2'' genes. Please add here any relevant information pertaining to these genes, if it is not represented elsewhere on Xenbase. =annotation and synteny= Note that this gene is a duplicate of the adjacent ''rho'' gene, on Chromosome 4, but is only seen in ''X. laeivs'' L subgenome. In v10 assemblies: ''Xtr.chr4: mbd4< ift122> rho> h1-8> plxnd1<'' ''Xla.4L:mbd4.L< ift122.L> rho.L> '''rho.2.L>''' h1-8.L>...")
• 11:00, 18 October 2023 Xenbase talk contribs created page XB-FEAT-22065720 (Created page with "=opn7a= =summary from NCBI= Predicted to enable G protein-coupled receptor activity and photoreceptor activity. Acts upstream of or within phototransduction. Predicted to be located in membrane. Predicted to be integral component of membrane. Is expressed in several structures, including brain; digestive system; eye; heart; and testis. [provided by Alliance of Genome Resources, Apr 2022]")
• 12:01, 17 October 2023 Xenbase talk contribs created page XB-FEAT-29083966 (Created page with "= opn6bl= This is the Xenbase wiki page for the Xenopus genes 'opn6bl''. Fee; free to record anything here about these genes a=thata are not recorded elsewhere on Xenbase. =nomenclature changes= 18OCT2023 The gene symbol and names for the opsin gens where updated, provisionally, replacing the ''LOC 100497987, visual pigment-like receptor peropsin'' with ''opn6bl, visual pigment-like receptor peropsin 6b like'', which combines the X.tropicalis gene /protein name with th...")