XB-FEAT-22169522

From XenWiki
Revision as of 10:15, 4 January 2023 by Christina (talk | contribs) (Created page with "==''mypop2''== This is the community page for the ''Xenopus'' gene ''mypop2'', please make notes here about this gene, noting anything that is not recorded elsewhere on Xenbas...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

mypop2

This is the community page for the Xenopus gene mypop2, please make notes here about this gene, noting anything that is not recorded elsewhere on Xenbase.

nomenclature changes

04JAN2023

the name of this gene was updated from "unnamed" to Myb related transcription factor, partner of profilin 2, mypop2, following a quick analysis by Xenbase curation staff.

The protein sequence was entered into a EggNogg, a DIOPT orthology group analysis tool, and this protein was a very high scoring match to MYPOP in 71 species. True MYPOP orthologues in Xenopus are on Chromosome 8/8L/8S, whereas this gene is found on chromosome 5/5L/5S in the current genome assembly (v10). As this gene likely represents a 2nd MYPOP ortholog, we have provisionally assigned the gene symbol mypop2 as it is not currently in use elsewhere, and the gene and gene name are suffixed with 'provisional' to indictae this status.

Xenbase will consult with HGNC for gene name/symbol approval


=protein sequence for X. tropicalis mypop2

MPGYVVSGYGLFWWRMEENFLFLGTVGTYPSAPGNMMKREPREEMGGCSQGIKREVPDISPGLSDGTPNIIVKIEPDGESYGWSPKLNGV QETAAEPGIQQHYRANMATPMDESQQHHRANMAAPMDESQQQAERERQRKARFSEEENDVLINSVMPHYDKLFGKLATRTSTAVKNALWR EIASAVNAISAYPRSLQNCKKRYADVKRKVKEKLCKVAKQRRATGGTVPLNISFWPYERIMEKIISADAIAAVPGATDSGRMADPTAAGP SDFDAECEYFPDIQDESGSARSEMEDSQMPLHHFPADKEDPRIVHMDGGIPDPQEETRIVQEEPSRERGQNPCRSLPNPKSREPWSPRYH SMRDHTTLIYAEQSHFRRTMAKKLDILNSNVKALNKNVKAFQHSFNQSIMALSQSVQQQNSIFEKLSSNLLLMAQQQQQHNQLCMSAIKQ IFQIFPSSAESLSVPNAVPSDAPSEIQTLKVPQAPCAHRHEATEPRRPSSPSGEAAKRRRH