XB-FEAT-22169522
mypopl1
This is the community page for the Xenopus mypopl1 genes. Please feel free to make notes here about these genes, noting anything that is not recorded elsewhere on Xenbase.
nomenclature changes
04JAN2023
the name of this gene was updated from "unnamed" to Myb related transcription factor, partner of profilin 2, mypop2, following a quick analysis by Xenbase curation staff.
The protein sequence was entered into a EggNogg, a DIOPT orthology group analysis tool, and this protein was a very high scoring match to MYPOP in 71 species. True MYPOP orthologues in Xenopus are on Chromosome 8/8L/8S, whereas this gene is found on chromosome 5/5L/5S in the current genome assembly (v10). As this gene likely represents a 2nd MYPOP ortholog, we have provisionally assigned the gene symbol mypop2 as it is not currently in use elsewhere, and the gene and gene name are suffixed with 'provisional' to indictae this status.
Xenbase will consult with HGNC for gene name/symbol approval
07 JUNE 2023
Further investigation of uncharacterized LOC# genes in v10 Xenopus genomes found another cluster of MYPOP genes, but these seems Xenopus specific.
Considering synteny and DIOPT homology/ortholgy analysis, these genes have been (more conservativley) renamed, changing from provisonal mypop2 to mypop like 1 (mypopl1).
A new gene page will be requested for mypopl2 genes, and the 2 additional duplicates in X. laevis (mypopl2.2 and mypopl2.3)
protein sequence for X. tropicalis mypopl1
MPGYVVSGYGLFWWRMEENFLFLGTVGTYPSAPGNMMKREPREEMGGCSQGIKREVPDISPGLSDGTPNIIVKIEPDGESYGWSPKLNGV QETAAEPGIQQHYRANMATPMDESQQHHRANMAAPMDESQQQAERERQRKARFSEEENDVLINSVMPHYDKLFGKLATRTSTAVKNALWR EIASAVNAISAYPRSLQNCKKRYADVKRKVKEKLCKVAKQRRATGGTVPLNISFWPYERIMEKIISADAIAAVPGATDSGRMADPTAAGP SDFDAECEYFPDIQDESGSARSEMEDSQMPLHHFPADKEDPRIVHMDGGIPDPQEETRIVQEEPSRERGQNPCRSLPNPKSREPWSPRYH SMRDHTTLIYAEQSHFRRTMAKKLDILNSNVKALNKNVKAFQHSFNQSIMALSQSVQQQNSIFEKLSSNLLLMAQQQQQHNQLCMSAIKQ IFQIFPSSAESLSVPNAVPSDAPSEIQTLKVPQAPCAHRHEATEPRRPSSPSGEAAKRRRH