XB-FEAT-22164552

From XenWiki
Revision as of 13:15, 4 January 2023 by Christina (talk | contribs) (Created page with " =''csta''= This is the community wiki page for the gene ''csta'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

csta

This is the community wiki page for the gene csta please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase.


protein sequence

MEGICGGTGAQKVADAEVQEICDKVKAEFLEKSGVNTSLFKAVSYKTQQVAGTNYFIKVNIGDDKCVHIRVYRIVGEQMEALRFDSFLLD KTMEEEIVYF


this protein has a Cystatin-like domain, and is predicted to have cysteine-type endopeptidase inhibitor activity.

The DIOPT EggNogg tool groups it with CSTA CSTB and STFA2 gene from Mouse, Rat and 120 other species, and cst14a.1, zgc:153129, zgc:56530 in Danio Rerio (Zebrafish). This is good eveidence it is a cystantin, but cannot tell if it shoudl be cystatin A or cystatin B

nomenclature changes

based on above quick analysis, this gene is provisonaly renamed cystain A, with gene symbol csta