User contributions for Xenbase

12:3012:30, 18 December 2023 diff hist +164‎ XB-FEAT-5886445 ‎ →‎nomenclature changes

13:5713:57, 14 December 2023 diff hist +4‎ XB-FEAT-22164454 ‎ →‎tff3.5
13:5713:57, 14 December 2023 diff hist +399‎ N XB-FEAT-22164454 ‎ Created page with "=tff3.5= This is the Xenbase community wiki page for ''Xenopus ''tff3.5'' genes. Please feel free to record here any relevant information about these ones, that is not already represented on the gene page or elsewhere on Xenbase. =genome annotation notes= 12DEC2023 note that ''tff3.5.S'' is not annoatated on the ''X. laevis'' v10 genome release. We looked, and couldn't find a v10.1 model for it."

11:1911:19, 11 December 2023 diff hist +139‎ XB-FEAT-29084766 ‎ →‎protein current
10:5110:51, 11 December 2023 diff hist +35‎ XB-FEAT-29084766 ‎ →‎synteny
10:4910:49, 11 December 2023 diff hist +289‎ XB-FEAT-29084766 ‎ →‎homology group analysis via EggNOGG v5
10:4810:48, 11 December 2023 diff hist −270‎ XB-FEAT-29084766 ‎ →‎nomenclature changes
10:4810:48, 11 December 2023 diff hist +57‎ XB-FEAT-29084766 ‎ →‎homology group analysis via EggNOGG v5
10:2510:25, 11 December 2023 diff hist 0‎ XB-FEAT-29084766 ‎ →‎synteny
10:2410:24, 11 December 2023 diff hist +501‎ XB-FEAT-29084766 ‎ →‎homology group analysis via EggNOGG v5
10:2410:24, 11 December 2023 diff hist −8‎ XB-FEAT-29084766 ‎ →‎synteny
10:2110:21, 11 December 2023 diff hist +2,020‎ N XB-FEAT-29084766 ‎ Created page with " =protein= uncharacterized protein '''LOC101730711''' [Xenopus tropicalis] NCBI Reference Sequence: XP_017952313.2 >XP_017952313.2 uncharacterized protein LOC101730711 [Xenopus tropicalis] MCHILIFILLFLFLFQRKICEGRGRLSCPAVMGPARLHPFIILLGLFHLFLSSTSAVKVENFTLFEEKLK LEAHTANMIPCVFHTRRRLNPLRVQLEWGKMDKEGYVPLIHLDGNHVRKAAADFGDKYQLFIPQVSQGNC SLVINPMDIADSGTYQVRLRILGKLYEPVPSIEIQVVDQRKVESRAWGKKKTTVPPTTIATVPPGFVDDV QKRLVKIDKMAIIAIILNGVFVGIAILLGVLVFITYRKKSSSGDEENPPKKRKQKGKKEPSDESEESSSS..."

15:2515:25, 5 December 2023 diff hist +1‎ XB-FEAT-483692 ‎ →‎pax8 current
10:3410:34, 5 December 2023 diff hist +14‎ N XB-FEAT-22169226 ‎ Created page with "=''chst9l.2''=" current
10:3310:33, 5 December 2023 diff hist −6‎ XB-FEAT-967555 ‎ →‎chst9l.2 current
10:3310:33, 5 December 2023 diff hist +10‎ XB-FEAT-967555 ‎ →‎chst7

14:5414:54, 4 December 2023 diff hist −6‎ XB-FEAT-483692 ‎No edit summary Tag: Manual revert
14:5314:53, 4 December 2023 diff hist +6‎ XB-FEAT-483692 ‎No edit summary Tag: Reverted
13:4613:46, 4 December 2023 diff hist +1,388‎ N XB-FEAT-29078026 ‎ Created page with "=''chst1l''= =protein > homology group> nomenclature notes= 12.04.2023 protein: carbohydrate sulfotransferase 1 [Xenopus laevis] NCBI Reference Sequence: XP_018107451.1 >XP_018107451.1 carbohydrate sulfotransferase 1 [Xenopus laevis] MECSWKAVVLLVFASLGIQYTAIKSLRTAFKSPCQVMGGESRCFQRDLRDNASRLLCEDLGQVNRKHIIL LATTRSGSSFLGQIFNQNPDIFYLYEPLYHVQRAFTNSSTRMQKQIDRRSLLGAYRDLLHNLYNCDFYFL ENYLRPAPKDHETTSFFRRGASNALCLPPVCEQLHPIEEHLCSKKCRTVNLTLVSKSCHQYKHMAIKTVR IPEINDIRTLVEDPRLNLKVIH..." current
13:0113:01, 4 December 2023 diff hist +312‎ XB-FEAT-960884 ‎ →‎chst6 current

08:2608:26, 30 November 2023 diff hist +3‎ XB-FEAT-1000743 ‎ →‎synteny map
08:2508:25, 30 November 2023 diff hist +179‎ XB-FEAT-1000743 ‎ →‎synteny map
08:2008:20, 30 November 2023 diff hist +813‎ XB-FEAT-1000743 ‎ →‎synteny map
08:2008:20, 30 November 2023 diff hist +815‎ XB-FEAT-483145 ‎ →‎synteny current
07:5107:51, 30 November 2023 diff hist +12‎ XB-FEAT-1000743 ‎No edit summary
07:4907:49, 30 November 2023 diff hist −51‎ XB-FEAT-1000743 ‎ →‎synteny map
07:4607:46, 30 November 2023 diff hist +978‎ N File:Six6 synteny.png ‎No edit summary current
07:4307:43, 30 November 2023 diff hist +751‎ XB-FEAT-1000743 ‎ →‎nomenclature changes

14:2214:22, 29 November 2023 diff hist −1‎ XB-FEAT-483145 ‎ →‎six6
14:2114:21, 29 November 2023 diff hist +19‎ XB-FEAT-483145 ‎ →‎synteny
14:1614:16, 29 November 2023 diff hist +169‎ XB-FEAT-483145 ‎ →‎synteny
14:1114:11, 29 November 2023 diff hist +132‎ XB-FEAT-483145 ‎ →‎six6
10:1210:12, 29 November 2023 diff hist +1,135‎ XB-FEAT-6257418 ‎No edit summary current
08:1408:14, 29 November 2023 diff hist −385‎ XB-FEAT-22065720 ‎ →‎Summary from NCBI current
08:1308:13, 29 November 2023 diff hist +503‎ XB-FEAT-22065720 ‎ →‎nomenclature notes
08:0908:09, 29 November 2023 diff hist −1‎ XB-FEAT-22065720 ‎ →‎nomenclature notes
08:0908:09, 29 November 2023 diff hist −2‎ XB-FEAT-22065720 ‎ →‎nomenclature notes

10:5510:55, 20 November 2023 diff hist +995‎ XB-FEAT-992773 ‎No edit summary current
10:0010:00, 20 November 2023 diff hist +38‎ XB-FEAT-6049731 ‎ →‎Synteny current
09:4109:41, 20 November 2023 diff hist +1,353‎ XB-FEAT-6049731 ‎ →‎gabra6
09:0909:09, 20 November 2023 diff hist +416‎ XB-FEAT-992773 ‎ →‎gabra3

13:2913:29, 30 October 2023 diff hist +1,982‎ Reporting Bugs ‎ →‎Reporting a bug in Xenbase current

14:3714:37, 18 October 2023 diff hist +1,578‎ XB-FEAT-5959819 ‎ →‎unnamed current
14:3714:37, 18 October 2023 diff hist −753‎ XB-FEAT-940811 ‎ →‎synteny current Tag: Blanking
14:3714:37, 18 October 2023 diff hist −823‎ XB-FEAT-940811 ‎ →‎nomenclature changes
14:3714:37, 18 October 2023 diff hist −190‎ XB-FEAT-940811 ‎ →‎gpr4l
14:2214:22, 18 October 2023 diff hist +4‎ XB-FEAT-940811 ‎ →‎gpr4l
14:2214:22, 18 October 2023 diff hist +16‎ XB-FEAT-940811 ‎ →‎synteny
14:2114:21, 18 October 2023 diff hist +1,565‎ XB-FEAT-940811 ‎ →‎gpr4
14:2114:21, 18 October 2023 diff hist +8‎ XB-FEAT-5853032 ‎ →‎nomenclature changes current
14:1514:15, 18 October 2023 diff hist +14‎ XB-FEAT-5853032 ‎ →‎nomenclature changes
14:1414:14, 18 October 2023 diff hist +1,540‎ XB-FEAT-5853032 ‎ →‎mgc69520
14:1214:12, 18 October 2023 diff hist +108‎ N File:Screenshot 2023-10-18 at 4.10.09 PM.png ‎No edit summary current
13:3813:38, 18 October 2023 diff hist +549‎ N XB-FEAT-18034121 ‎ Created page with "=''rho.2''= This is the community wiki page for the ''Xenopus rho.2'' genes. Please add here any relevant information pertaining to these genes, if it is not represented elsewhere on Xenbase. =annotation and synteny= Note that this gene is a duplicate of the adjacent ''rho'' gene, on Chromosome 4, but is only seen in ''X. laeivs'' L subgenome. In v10 assemblies: ''Xtr.chr4: mbd4< ift122> rho> h1-8> plxnd1<'' ''Xla.4L:mbd4.L< ift122.L> rho.L> '''rho.2.L>''' h1-8.L>..." current
12:3012:30, 18 October 2023 diff hist +5‎ XB-FEAT-1018916 ‎ →‎tmtopn3 current
12:3012:30, 18 October 2023 diff hist +18‎ XB-FEAT-1018916 ‎ →‎gene nomenclature
12:1112:11, 18 October 2023 diff hist +496‎ XB-FEAT-22065720 ‎ →‎summary from NCBI
12:0112:01, 18 October 2023 diff hist +174‎ XB-FEAT-22065720 ‎ →‎opn7a
12:0012:00, 18 October 2023 diff hist +392‎ N XB-FEAT-22065720 ‎ Created page with "=opn7a= =summary from NCBI= Predicted to enable G protein-coupled receptor activity and photoreceptor activity. Acts upstream of or within phototransduction. Predicted to be located in membrane. Predicted to be integral component of membrane. Is expressed in several structures, including brain; digestive system; eye; heart; and testis. [provided by Alliance of Genome Resources, Apr 2022]"
06:4206:42, 18 October 2023 diff hist +306‎ XB-FEAT-6076481 ‎ →‎rrh current

13:0213:02, 17 October 2023 diff hist +4‎ XB-FEAT-29083966 ‎ →‎opn6bl Tag: Manual revert
13:0213:02, 17 October 2023 diff hist −4‎ XB-FEAT-29083966 ‎No edit summary Tags: Manual revert Reverted
13:0213:02, 17 October 2023 diff hist +4‎ XB-FEAT-29083966 ‎ →‎opn6bl Tag: Reverted
13:0113:01, 17 October 2023 diff hist +803‎ N XB-FEAT-29083966 ‎ Created page with "= opn6bl= This is the Xenbase wiki page for the Xenopus genes 'opn6bl''. Fee; free to record anything here about these genes a=thata are not recorded elsewhere on Xenbase. =nomenclature changes= 18OCT2023 The gene symbol and names for the opsin gens where updated, provisionally, replacing the ''LOC 100497987, visual pigment-like receptor peropsin'' with ''opn6bl, visual pigment-like receptor peropsin 6b like'', which combines the X.tropicalis gene /protein name with th..."
12:2212:22, 17 October 2023 diff hist +1,160‎ XB-FEAT-1018914 ‎ →‎tmtops current
12:2012:20, 17 October 2023 diff hist −6‎ XB-FEAT-990435 ‎ →‎gene nomenclature current
12:1712:17, 17 October 2023 diff hist +1,163‎ XB-FEAT-1018916 ‎ →‎tmtops.2
12:1512:15, 17 October 2023 diff hist −4‎ XB-FEAT-990435 ‎ →‎gene nomenclature
12:1312:13, 17 October 2023 diff hist +3‎ XB-FEAT-990435 ‎ →‎tmtopn2
12:1312:13, 17 October 2023 diff hist +1,160‎ XB-FEAT-990435 ‎ →‎loc100490436
08:3808:38, 17 October 2023 diff hist +1‎ XB-FEAT-5826965 ‎ →‎LOC373730 current
08:0008:00, 17 October 2023 diff hist +63‎ XB-FEAT-5826965 ‎ →‎nomenclature changes
07:4007:40, 17 October 2023 diff hist 0‎ XB-FEAT-5729392 ‎ →‎mrps36 current
07:4007:40, 17 October 2023 diff hist +338‎ XB-FEAT-5729392 ‎ →‎mrps36

09:4509:45, 10 October 2023 diff hist +13‎ XB-FEAT-989872 ‎ →‎nomenclature notes current
09:4509:45, 10 October 2023 diff hist +288‎ XB-FEAT-989872 ‎ →‎nomenclature notes
08:0308:03, 10 October 2023 diff hist +2,724‎ N XB-FEAT-22063928 ‎ Created page with "=''notch4''= This is the community wiki page for the gene ''notch4'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase. =gene nomenclature and annotation notes= In ''X. laevis'', on chromosome 8L, LOC121397048 is the gene next to ''tap2.L'' and we propose that represents a non-coding fragment of ''notch4''. This annotation was based on BLAST of notch4.S XM_041575228.1, which identified the loci n..." current

14:4914:49, 9 October 2023 diff hist 0‎ N File:Undefined-4.pdf ‎No edit summary current
14:4814:48, 9 October 2023 diff hist 0‎ N File:Undefined-3.pdf ‎No edit summary current
14:4814:48, 9 October 2023 diff hist +1,421‎ XB-FEAT-22062677 ‎ →‎synteny current
14:3814:38, 9 October 2023 diff hist +4‎ XB-FEAT-22062677 ‎ →‎gja4
14:3114:31, 9 October 2023 diff hist +153‎ XB-FEAT-22062677 ‎ →‎nomenclature changes
14:2914:29, 9 October 2023 diff hist +239‎ XB-FEAT-22062677 ‎ →‎nomenclature
14:2414:24, 9 October 2023 diff hist 0‎ XB-FEAT-22062677 ‎ →‎cx38
13:0713:07, 9 October 2023 diff hist +31‎ XB-FEAT-22062677 ‎ →‎synteny
13:0413:04, 9 October 2023 diff hist +18‎ XB-FEAT-22062677 ‎ →‎nomenclature
13:0313:03, 9 October 2023 diff hist +86‎ XB-FEAT-22062677 ‎ →‎nomenclature
13:0213:02, 9 October 2023 diff hist +1,354‎ N XB-FEAT-22062677 ‎ Created page with "=''cx38''= This is the community wiki page for the gene ''cx38'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase. =nomenclature= 09 OCTOBER 2023 Note: no other vertebrate genes are called ''cx38'', just ''X. trop'' GeneID:100170463, and ''X. laevis'' GeneID:397866. The Synonym given is ''gja2'', which in NCBI is currently only assigned to genes in a large number of fish species, but no other vert..."

11:3511:35, 6 October 2023 diff hist +6‎ Stage 44 ‎No edit summary current

15:1715:17, 5 October 2023 diff hist 0‎ Stage 44 ‎No edit summary
15:1415:14, 5 October 2023 diff hist 0‎ N File:Stage44ventral.jpg ‎No edit summary current
15:1315:13, 5 October 2023 diff hist +4‎ Stage 44 ‎No edit summary
15:1315:13, 5 October 2023 diff hist −1‎ Stage 44 ‎No edit summary
13:2213:22, 5 October 2023 diff hist 0‎ File:Herbimycin.png ‎ Xenbase uploaded File:Herbimycin.png current
10:5110:51, 5 October 2023 diff hist 0‎ File:Krylov FISH-TSA protocol.pdf ‎ Xenbase uploaded File:Krylov FISH-TSA protocol.pdf current
10:5010:50, 5 October 2023 diff hist 0‎ File:Slc45a2 - Start Codon - Consensus.pdf ‎ Xenbase uploaded File:Slc45a2 - Start Codon - Consensus.pdf current
10:5010:50, 5 October 2023 diff hist 0‎ File:Slc45a2 - tBLASTn.pdf ‎ Xenbase uploaded File:Slc45a2 - tBLASTn.pdf current
10:4910:49, 5 October 2023 diff hist 0‎ File:Slc45a2 - Multi-sequence alignment.pdf ‎ Xenbase uploaded File:Slc45a2 - Multi-sequence alignment.pdf current
07:2107:21, 5 October 2023 diff hist −2‎ XB-FEAT-966538 ‎ →‎notes on adam11 current
07:2107:21, 5 October 2023 diff hist +1,370‎ XB-FEAT-966538 ‎ →‎synonyms
07:1707:17, 5 October 2023 diff hist +5‎ XB-FEAT-966538 ‎ →‎adam11

07:4707:47, 3 October 2023 diff hist 0‎ XB-FEAT-487651 ‎ →‎nomenclature changes current
07:4707:47, 3 October 2023 diff hist +298‎ XB-FEAT-487651 ‎ →‎nomenclature changes
07:4407:44, 3 October 2023 diff hist +3‎ XB-FEAT-487651 ‎ →‎il1r1

13:1913:19, 2 October 2023 diff hist +16‎ XB-FEAT-5765837 ‎ →‎synteny and orthology current
13:0813:08, 2 October 2023 diff hist +1‎ XB-FEAT-993484 ‎ →‎Synteny and v10 model annoation current
13:0713:07, 2 October 2023 diff hist +1‎ XB-FEAT-993484 ‎ →‎Synteny and v10 model annoation
13:0613:06, 2 October 2023 diff hist +8‎ XB-FEAT-993484 ‎ →‎Synteny and v10 model annoation
13:0613:06, 2 October 2023 diff hist +634‎ XB-FEAT-993484 ‎ →‎adam19
12:5512:55, 2 October 2023 diff hist +13‎ XB-FEAT-29085838 ‎ →‎background to resolution of adam13 v adam33 names in Xenopus current
12:3512:35, 2 October 2023 diff hist +90‎ XB-FEAT-12564498 ‎ →‎nomenclature changes current
12:3312:33, 2 October 2023 diff hist +2,225‎ XB-FEAT-12564498 ‎ →‎nomenclature changes
12:0412:04, 2 October 2023 diff hist −934‎ XB-FEAT-12564498 ‎ →‎summary for human COL11A2
12:0412:04, 2 October 2023 diff hist +933‎ XB-FEAT-876668 ‎ →‎nomenclature changes current
12:0312:03, 2 October 2023 diff hist +2‎ XB-FEAT-12564498 ‎ →‎col11a2
11:5311:53, 2 October 2023 diff hist +163‎ XB-FEAT-876668 ‎ →‎nomenclature changes
11:4911:49, 2 October 2023 diff hist 0‎ XB-FEAT-876668 ‎ →‎Orthology and syntey
11:4811:48, 2 October 2023 diff hist −1‎ XB-FEAT-876668 ‎ →‎Orthology and syntey
11:4811:48, 2 October 2023 diff hist +1,208‎ XB-FEAT-876668 ‎ →‎nomenclature changes
11:4211:42, 2 October 2023 diff hist −2‎ XB-FEAT-876668 ‎ →‎col11a2p
10:3310:33, 2 October 2023 diff hist +4‎ XB-FEAT-5748509 ‎ →‎inmt current
10:3310:33, 2 October 2023 diff hist +4‎ XB-FEAT-5814630 ‎ →‎loc100496844 current
10:1110:11, 2 October 2023 diff hist +4‎ XB-FEAT-876668 ‎ →‎col11a2p
08:2508:25, 2 October 2023 diff hist +7‎ XB-FEAT-5889258 ‎ →‎nomenclature changes current
08:2308:23, 2 October 2023 diff hist −2‎ XB-FEAT-5889258 ‎ →‎mhc2-daa.2
07:4607:46, 2 October 2023 diff hist +11‎ XB-FEAT-29093450 ‎ →‎Table: Xenopus cyp27a1 protein accession and name changes current
07:4507:45, 2 October 2023 diff hist +1‎ XB-FEAT-29093450 ‎ →‎cyp27a1.2
07:4507:45, 2 October 2023 diff hist +3,963‎ N XB-FEAT-29093450 ‎ Created page with "=''cyp27a1.2''= his is the community wiki page for the gene ''cyp27a1.2'' please feel free to add any information that is relevant to this gene that is not already captured el..."
07:3907:39, 2 October 2023 diff hist −4‎ XB-FEAT-18386060 ‎ →‎cyp27a1.1 current
07:0807:08, 2 October 2023 diff hist +174‎ XB-FEAT-5826965 ‎ →‎nomenclature changes
07:0207:02, 2 October 2023 diff hist −9‎ XB-FEAT-22068060 ‎ →‎c3h12orf40 current
07:0207:02, 2 October 2023 diff hist +323‎ XB-FEAT-22068060 ‎ →‎nomenclature changes
06:5406:54, 2 October 2023 diff hist +364‎ XB-FEAT-5953233 ‎ →‎kiaa2026 current

12:5012:50, 26 September 2023 diff hist +1,736‎ XB-FEAT-29072384 ‎ →‎b3galt2l.13 current
12:5012:50, 26 September 2023 diff hist +30‎ XB-FEAT-29072327 ‎ →‎nomenclature updates current
12:4912:49, 26 September 2023 diff hist +30‎ XB-FEAT-29072331 ‎ →‎nomenclature updates current
12:4812:48, 26 September 2023 diff hist +30‎ XB-FEAT-29072376 ‎ →‎nomenclature updates current
12:4812:48, 26 September 2023 diff hist −24‎ XB-FEAT-29072323 ‎ →‎nomenclature updates current
12:4712:47, 26 September 2023 diff hist −24‎ XB-FEAT-29072343 ‎ →‎nomenclature updates current
12:4612:46, 26 September 2023 diff hist −23‎ XB-FEAT-29072311 ‎ →‎nomenclature updates current
12:4512:45, 26 September 2023 diff hist +2‎ XB-FEAT-29072339 ‎ →‎nomenclature updates current
12:4312:43, 26 September 2023 diff hist +35‎ XB-FEAT-29072396 ‎ →‎nomenclature updates current
12:4212:42, 26 September 2023 diff hist +35‎ XB-FEAT-29072315 ‎ →‎nomenclature updates current
12:4212:42, 26 September 2023 diff hist +35‎ XB-FEAT-29072356 ‎ →‎nomenclature updates current
12:4112:41, 26 September 2023 diff hist +30‎ XB-FEAT-29072368 ‎ →‎nomenclature updates current
12:4012:40, 26 September 2023 diff hist +35‎ XB-FEAT-29072360 ‎ →‎nomenclature changes current
12:3912:39, 26 September 2023 diff hist +1,956‎ N XB-FEAT-29072323 ‎ Created page with "=''b3galt2l.9''= This is the community wiki page for the gene ''b3galt2l.9'' please feel free to add any information that is relevant to this gene that is not already capture..."
12:3812:38, 26 September 2023 diff hist +1,956‎ N XB-FEAT-29072343 ‎ Created page with "=''b3galt2l.8''= This is the community wiki page for the gene ''b3galt2l.8'' please feel free to add any information that is relevant to this gene that is not already capture..."
12:3712:37, 26 September 2023 diff hist +1,956‎ N XB-FEAT-29072311 ‎ Created page with "=''b3galt2l.7''= This is the community wiki page for the gene ''b3galt2l.7'' please feel free to add any information that is relevant to this gene that is not already capture..."
12:3512:35, 26 September 2023 diff hist +1,930‎ N XB-FEAT-29072339 ‎ Created page with "=''b3galt2l.6''= This is the community wiki page for the gene ''b3galt2l.6'' please feel free to add any information that is relevant to this gene that is not already capture..."
12:3312:33, 26 September 2023 diff hist +1,902‎ N XB-FEAT-29072396 ‎ Created page with "=''b3galt2l.5''= This is the community wiki page for the gene ''b3galt2l.5'' please feel free to add any information that is relevant to this gene that is not already capture..."
12:3212:32, 26 September 2023 diff hist +1,902‎ N XB-FEAT-29072315 ‎ Created page with "=''b3galt2l.4''= This is the community wiki page for the gene ''b3galt2l.4'' please feel free to add any information that is relevant to this gene that is not already capture..."
12:3112:31, 26 September 2023 diff hist +1,902‎ N XB-FEAT-29072356 ‎ Created page with "=''b3galt2l.3''= This is the community wiki page for the gene ''b3galt2l.3'' please feel free to add any information that is relevant to this gene that is not already capture..."
12:3112:31, 26 September 2023 diff hist +1,902‎ N XB-FEAT-29072368 ‎ Created page with "=''b3galt2l.2''= This is the community wiki page for the gene ''b3galt2l.2'' please feel free to add any information that is relevant to this gene that is not already capture..."
12:3012:30, 26 September 2023 diff hist +1,904‎ N XB-FEAT-29072327 ‎ Created page with "=''b3galt2l.12''= This is the community wiki page for the gene ''b3galt2l.12'' please feel free to add any information that is relevant to this gene that is not already captu..."
12:3012:30, 26 September 2023 diff hist +1,904‎ N XB-FEAT-29072331 ‎ Created page with "=''b3galt2l.11''= This is the community wiki page for the gene ''b3galt2l.11'' please feel free to add any information that is relevant to this gene that is not already captu..."
12:2912:29, 26 September 2023 diff hist +1,904‎ N XB-FEAT-29072376 ‎ Created page with "=''b3galt2l.10''= This is the community wiki page for the gene ''b3galt2l.10'' please feel free to add any information that is relevant to this gene that is not already captu..."
12:2812:28, 26 September 2023 diff hist +1,681‎ XB-FEAT-29072360 ‎ →‎nomenclature changes
12:0612:06, 26 September 2023 diff hist +199‎ N XB-FEAT-29072384 ‎ Created page with "=''b3galt2l.13''= This is the community wiki page for the gene ''b3galt2l.13'' please feel free to add any information that is relevant to this gene that is not already captu..."
12:0012:00, 26 September 2023 diff hist +4‎ XB-FEAT-22172613 ‎ →‎b3galt2 current
11:4911:49, 26 September 2023 diff hist +3‎ XB-FEAT-29072360 ‎ →‎b3galt2l.1
11:4911:49, 26 September 2023 diff hist +527‎ N XB-FEAT-29072360 ‎ Created page with "=b3galt2l.1= This is the community wiki page for the gene ''b3galt2l.1'' please feel free to add any information that is relevant to this gene that is not already captured els..."
11:4911:49, 26 September 2023 diff hist +390‎ XB-FEAT-5795333 ‎ →‎nomenclature changes current
11:1711:17, 26 September 2023 diff hist −189‎ XB-FEAT-6035125 ‎ →‎kiaa0467 current Tag: Blanking