All public logs
Jump to navigation
Jump to search
Combined display of all available logs of XenWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).
- 09:39, 14 May 2024 Xenbase talk contribs created page File:Screenshot 2024-05-14 at 11.36.25 AM.png
- 09:39, 14 May 2024 Xenbase talk contribs uploaded File:Screenshot 2024-05-14 at 11.36.25 AM.png
- 09:02, 4 April 2024 Xenbase talk contribs created page File:Nightingale.snapshot.png
- 09:02, 4 April 2024 Xenbase talk contribs uploaded File:Nightingale.snapshot.png
- 12:45, 1 April 2024 Xenbase talk contribs created page XB-FEAT-22164459 (Created page with "=''tff3.6''= This is the Xenbase wiki page for ''tff3.6'' genes- feel free to record here any information that is not captured elsewhere on Xenbase. = summary for TFF family from NCBI= Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. In mammals they are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not well defined, but...")
- 12:42, 1 April 2024 Xenbase talk contribs created page XB-FEAT-22164449 (Created page with "=''tff3.4''= This is the Xenbase wiki page for ''tff3.4'' genes- feel free to record here any information that is not captured elsewhere on Xenbase.")
- 12:39, 1 April 2024 Xenbase talk contribs created page XB-FEAT-22164444 (Created page with "=''tff3.4''= This is the Xenbase wiki page for ''tff3.4'' genes- feel free to record here any information that is not captured elsewhere on Xenbase. = summary for TFF family from NCBI= Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. In mammals they are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not well defined, bu...")
- 12:36, 1 April 2024 Xenbase talk contribs created page XB-FEAT-6462248 (Created page with "=''tff3.7''= This is the Xenbase wiki page for ''tff3.7'' genes- feel free to record here any information that is not captured elsewhere on Xenbase. = summary for TFF family from NCBI= Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. In mammals they are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not well defined, bu...")
- 11:19, 1 April 2024 Xenbase talk contribs created page XB-FEAT-18006555 (Created page with "=''tff3.2''=")
- 12:41, 28 March 2024 Xenbase talk contribs created page XB-FEAT-29097510 (Created page with "=''pgla.4''= This is the Xenbase wiki page for ''Xenopus'' ''pgla.4'' genes. Please record here anything that is not captured elsewhere on Xenbase. =Nomenclature updates= 28MARCH2024 The ‘’Xenopus’’ ‘’pgla’’ genes on Chr6/6L/6S, a cluster of tadem uncharacterized proteins, were assessed by Xenbase curators. Based on synteny, protein alignment and phylogenetic analysis, the following provisional gene nomenclature was decided upon. Note that in the v10...")
- 12:41, 28 March 2024 Xenbase talk contribs created page XB-FEAT-29097506 (Created page with "=''pgla.5''= This is the Xenbase wiki page for ''Xenopus'' ''pgla.5'' genes. Please record here anything that is not captured elsewhere on Xenbase. =Nomenclature updates= 28MARCH2024 The ‘’Xenopus’’ ‘’pgla’’ genes on Chr6/6L/6S, a cluster of tadem uncharacterized proteins, were assessed by Xenbase curators. Based on synteny, protein alignment and phylogenetic analysis, the following provisional gene nomenclature was decided upon. Note that in the v10...")
- 08:27, 28 March 2024 Xenbase talk contribs created page XB-FEAT-29091430 (Created page with "=''pgla.3''= This is the Xenbase wiki page for the ''Xenopus pgla.3'' genes. Feel free to record here any information about this genes that is not captured else where on Xenbase. =nomenclature changes= 28March2024 Following a quick assessment of the v10 NCBI annotation for X. laevis on chr6L, there appears to be a duplication of 3 ''pgla'' genes. Xla.chr6L: ulk4.L< trak1.L> '''LOC121394631.L(‘pgla-like’)< LOC780753.L(‘pgla.S’)< pgla.L<''' pgq.L< >levi.L...")
- 08:24, 28 March 2024 Xenbase talk contribs created page XB-FEAT-6492177 (Created page with "=''pgla''= This is the Xenbase wiki page for the ''Xenopus'' ''pgla'' genes. Feel free to record here any information about this genes that is not captured else where on Xenbase. =nomenclature changes= 28March2024 Following a quick assessment of the v10 NCBI annotation for X. laevis on chr6L, there appears to be a duplication of 3 ''pgla'' genes. Xla.chr6L: ulk4.L< trak1.L> '''LOC121394631.L(‘pgla-like’)< LOC780753.L(‘pgla.S’)< pgla.L<''' pgq.L< >levi.L...")
- 08:13, 28 March 2024 Xenbase talk contribs created page XB-FEAT-22067945 (Created page with "=''pgla.2''= This is the Xenbase wiki page for the Xenopus genes ''pgla.2''. Feel free to records here any information about these genes that is not captured elsewhere on Xenbase. =nomenclature changes= 28MARCH2024 In the v10 ''X.laevis'' NCBI annotation, this gene was incorrectly called ''pgla.S'', but it '''is placed on chromosome 6L'''. Synteny and the NCBI annotation name is as a prepro-PGLa, and as it falls adjacent to other prepro-PGLa genes, we have given it...")
- 10:00, 14 March 2024 Xenbase talk contribs created page XB-FEAT-29098766 (Created page with "=''LOC116412415'' = This is the community wiki page for ''LOC116412415''. Feel free to record here any information relevant to this gene that is not captured elsewhere on Xenbase. =annotation notes= 13MARCH2024 Xenbase curators updated the gene name for this protein, from uncharacterized to 'myb DNA binding protein 5', after searching for orthologs groups (OG) in DIOPTs EggNogg6.0 tool.")
- 07:19, 14 March 2024 Xenbase talk contribs created page XB-FEAT-29082598 (Created page with "=''cyp2k1.2''= This is the community wiki page for ''cyp2k1.2''. Feel free to record here any information relevant to this gene that is not captured elsewhere on Xenbase. =nomenclature changes= 12March2024 'Xenopus'' gene name changed from ''LOC100495200'' to ''cyp2k1.2'' following a assessment of synteny for this region of chr5/5L/5S, which contains are cluster of 30 cytochrome p450 genes. ''Xenopus'' nomenclature rules were applied for duplicated genes, and new gene...")
- 07:16, 14 March 2024 Xenbase talk contribs created page XB-FEAT-29081046 (Created page with "=''cyp2g1''= This is the community wiki page for ''cyp2g1''. Feel free to record here any information relevant to this gene that is not captured elsewhere on Xenbase. =nomenclature changes= 12March2024 'Xenopus'' gene name changed from ''LOC100492165, putative inactive cytochrome P450 2G1'' to ''cyp2g1, cytochrome P450 2G1'' following a assessment of synteny for this region of chr5/5L/5S, which contains are cluster of 30 cytochrome p450 genes. ''Xenopus'' nomenclature...")
- 07:10, 14 March 2024 Xenbase talk contribs created page XB-FEAT-29082542 (Created page with "=''cyp2k1.3''= This is the community wiki page for ''cyp2k1.3''. Feel free to record here any information relevant to this gene that is not captured elsewhere on Xenbase. =nomenclature changes= 12March2024 'Xenopus'' gene name changed from ''LOC100494424'' and ''XB5870673'' to ''cyp2k1.7'' following a assessment of synteny for this region of chr5/5L/5S, which contains are cluster of 30 cytochrome p450 genes. ''Xenopus'' nomenclature rules were applied for duplicated ge...")
- 13:26, 13 March 2024 Xenbase talk contribs created page XB-FEAT-29080474 (Created page with "=''cyp2k6.1''= This is the community wiki page for ''cyp2k6.1''. Feel free to record here any information relevant to this gene that is not captured elsewhere on Xenbase. =nomenclature changes= 03.12.2024 'Xenopus'' gene name changed from ''LOC108716384'' and ''LOC100490986'' to ''cyp2k6.1'' following a assessment of synteny for this region of chr5/5L/5S, which contains are cluster of 30 cytochrome p450 genes. ''Xenopus'' nomenclature rules were applied for duplicated...")
- 13:19, 13 March 2024 Xenbase talk contribs created page XB-FEAT-29080766 (Created page with "=''cyp2k4.2''= This is the community wiki page for ''cyp2k4.2''. Feel free to record here any information relevant to this gene that is not captured elsewhere on Xenbase. =nomenclature changes= 12March2024 'Xenopus'' gene name changed from LOC100491603(cyp2k4) to ''cyp2k4.2'' following a assessment of synteny for this region of chr5/5L/5S, which contains are cluster of 30 cytochrome p450 genes. ''Xenopus'' nomenclature rules were applied for duplicated genes, and new g...")
- 13:12, 13 March 2024 Xenbase talk contribs created page XB-FEAT-29086002 (Created page with "=''cyp2k1.4''= This is the community wiki page for ''cyp2k1.4''. Feel free to record here any information relevant to this gene that is not captured elsewhere on Xenbase. =nomenclature changes= 12.03.2024 'Xenopus'' gene name changed from LOC101732279 (cyp2k1-like) to ''cyp2k1.4'' following a assessment of synteny for this region of chr5/5L/5S, which contains are cluster of 30 cytochrome p450 genes. ''Xenopus'' nomenclature rules were applied for duplicated genes, and...")
- 13:09, 13 March 2024 Xenbase talk contribs created page XB-FEAT-29082450 (Created page with "=''cyp2k1.5''= This is the community wiki page for ''cyp2k1.5''. Feel free to record here any information relevant to this gene that is not captured elsewhere on Xenbase. =nomenclature changes= 12March2024 'Xenopus'' gene name changed from LOC100494900 (cyp2k1-like) to ''cyp2k1.5'' following a assessment of synteny for this region of chr5/5L/5S, which contains are cluster of 30 cytochrome p450 genes. ''Xenopus'' nomenclature rules were applied for duplicated genes, and...")
- 13:05, 13 March 2024 Xenbase talk contribs created page XB-FEAT-29082322 (Created page with "=''cyp2k1.6''= This is the community wiki page for ''cyp2k1.6''. Feel free to record here any information relevant to this gene that is not captured elsewhere on Xenbase. =nomeclature changes= 12March2024 'Xenopus'' gene name changed from LOC100494741 (cyp2k1-like) to ''cyp2k1.6'' following a assessment of synteny for this region of chr5/5L/5S, which contains are cluster of 30 cytochrome p450 genes. ''Xenopus'' nomenclature rules were applied for duplicated genes, and...")
- 11:51, 13 March 2024 Xenbase talk contribs created page XB-FEAT-29089578 (Created page with "=''cyp2k6.5''= =nomenclature changes= This is the community wiki page for ''cyp2k6.5''. Feel free to record here any information relevant to this gene that is not captured elsewhere on Xenbase. =nomenlcature changes= 12March2024 'Xenopus'' gene name changed from ''LOC105947503'' and ''LOC10871722'' to ''cyp2k6.5'' following a assessment of synteny for this region of chr5/5L/5S, which contains are cluster of 30 cytochrome p450 genes, where Xenopus nomenclature rules w...")
- 11:38, 13 March 2024 Xenbase talk contribs created page XB-FEAT-29081950 (Created page with "=''cyp2k6.3''= This is the community wiki page for ''cyp2k6.3''. Feel free to record here any information relevant to this gene that is not captured elsewhere on Xenbase. =nomenclature changes= 12MARCH2024 'Xenopus'' gene name changed from ''LOC100493928'' to ''cyp2k6.3'' following a assessment of synteny for this region of chr5/5L/5S, which contains are cluster of 30 cytochrome p450 genes, where ''Xenopus'' nomenclature rules were applied for duplicated genes, and ne...")
- 11:35, 13 March 2024 Xenbase talk contribs created page XB-FEAT-29082174 (Created page with "=cyp2k6.4= This is the community wiki page for ''cyp2k6.4''. Feel free to record here any information relevant to this gene that is not captured elsewhere on Xenbase. =nomenclature changes= 12MARCH2024 ''Xenopus'' gene name changed from ''LOC100494435'' to ''cyp2k6.4'' following a assessment of synteny for this region of chr5/5L/5S, which contains are cluster of 30 cytochrome p450 genes, where Xenopus nomenclature rules were applied for duplicated genes, and new gene...")
- 11:46, 11 March 2024 Xenbase talk contribs created page XB-FEAT-22251716 (Created page with "=''klc4''= This is the community wiki page for the ''Xenopus'' 'klc4'' genes. Feel free to record here any relevant information that is not captured elsewhere on Xenbase.")
- 14:43, 7 March 2024 Xenbase talk contribs created page XB-FEAT-29099390 (Created page with "=''sdcbp2''= This is the Xenbase wiki page for ''sdcbp2''. Feel free to record here any information not captured elsewhere on Xenbase. =nomenclature changes= =synteny= 05MAR2024 Xtrop: chr10: rv: ''pdyn>. nsfl1c>. fkbp1a> '''sdcbp2'''< snph< tmem74b> psmf1< fam110a<'' Xla.chr9_10L: ''pdyn.L> nsfl1c.L> LOC(lncRNA)< fkbp1a.L>. '''MGC52622'''> snph.L< tmem74b.L> psmf1.L< fam110a.L< scrt2.L>'' Xla.S: ''pdyn.S> nsfl1c.S> fkbp1a.S> snph.S< LOC> fam110a.S<. tmem74b...")
- 13:17, 7 March 2024 Xenbase talk contribs created page XB-FEAT-29081014 (Created page with "=uncharacterized genes LOC108700137 and LOC100492077= =synteny= Human. X: SLC25A43> SLC25A5> '''STEEP1'''< UBE2A> NKRF< SEPTIN6< ''Xtrop chr8: slc25a43> slc25a5> '''LOC100492077'''> ube2a> nkrt< nkap>'' ''Xla v10 8L: slc25a43.L> slc25a5.L> ... ube2a.L> nkrf.L< septin6.L<'' ''Xla v10 chr8S: LOC# slc25a5.S> '''LOC108700137'''> ube2a.S>. nkrf.S<'' Notes from synteny: ** the gene is NOT PRESENT IN XLA.L sub genome, although LOC108700137 and LOC100492077...")
- 14:14, 4 March 2024 Xenbase talk contribs created page XB-FEAT-29093330 (Created page with "=''gp2l''= This is the community wiki page for the gene ''gp2l'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase. =nomenclature changes= 04MAR2024 ''Xenopus'' gene name updated from the non-informative LOC#s to ''gp2l, pancreatic secretory granule membrane major glycoprotein GP2 like'' Note that the v9 Xla L gene model (Calle dLOC101733023) lacked an NCBI/Entrez gene ID, while the v10 model (Gene...")
- 09:13, 7 February 2024 Xenbase talk contribs created page XB-FEAT-29209259 (Created page with "=gfod3= There was an assigned model for an ''X. laevis'' ''gfod3.S'' gene but this clashed both in model ID and NCBi gene ID with the ''tp73.S'' gene. Subsequent investigation faored the ''tp73.S'' gene assignment so the model and NCBI gene associateion were removed from ''gfod3.S''. (2/7/2024)")
- 15:32, 5 February 2024 Xenbase talk contribs created page XB-FEAT-29079722 (Created page with "=''gucy2dl''= This is the Xenbase wiki page for the ''Xenopus gucy2dl'' gene(s). Please feel free to record here any relevant information that is not captured elsewhere on Xenbase. =nomenclature changes= 05FEB2024 ''Xenopus'' gene symbol change from LOC100489435 to ''gucy2dl''. Note that true ''gucy2d'', the ortholog of the human GUCY2D gene, is on chromosome 3 in ''X. tropicalis'', and this ''like'' gene is on Chr2.")
- 13:28, 31 January 2024 Xenbase talk contribs created page File:Screenshot 2024-01-31 at 9.06.08 AM.png
- 13:28, 31 January 2024 Xenbase talk contribs uploaded File:Screenshot 2024-01-31 at 9.06.08 AM.png
- 07:03, 8 January 2024 Xenbase talk contribs created page XB-FEAT-22041699 (Created page with "=fim-a.1=")
- 12:24, 4 January 2024 Xenbase talk contribs changed group membership for Christina from (none) to administrator and bureaucrat
- 12:24, 4 January 2024 Xenbase talk contribs changed group membership for Kkarimi from (none) to administrator, interface administrator, bureaucrat and suppressor
- 15:44, 3 January 2024 Xenbase talk contribs created page File:Figure 003.png (pattypan 22.03)
- 15:44, 3 January 2024 Xenbase talk contribs uploaded File:Figure 003.png (pattypan 22.03)
- 15:44, 3 January 2024 Xenbase talk contribs created page File:Figure 002.png (pattypan 22.03)
- 15:44, 3 January 2024 Xenbase talk contribs uploaded File:Figure 002.png (pattypan 22.03)
- 15:43, 3 January 2024 Xenbase talk contribs created page File:Figure 001.png (pattypan 22.03)
- 15:43, 3 January 2024 Xenbase talk contribs uploaded File:Figure 001.png (pattypan 22.03)
- 15:43, 3 January 2024 Xenbase talk contribs created page File:Different terminology for disease terms on pages.jpg (pattypan 22.03)
- 15:43, 3 January 2024 Xenbase talk contribs uploaded File:Different terminology for disease terms on pages.jpg (pattypan 22.03)
- 08:30, 3 January 2024 Xenbase talk contribs created page XB-FEAT-29209255 (Created page with "=nfil3l.2= This is the Xenbase wiki page for the ''Xenopus nfil3l.2'' genes. Please feel free to record here any information about these genes that is not captured elsewhere on Xenbase. =nomenclature changes= 01JAN2024 The ''Xenopus laevis nfil3l.2.L'', nuclear factor interleukin 3 regulated like gene 2 [NCBI GeneID: 447503] is on Chr4L, [v10 gene model: XBXL10_1g19722] and has been placed here on its own gene page. We can not find any paralogous ''nfil3l.2'' gene...")
- 13:57, 14 December 2023 Xenbase talk contribs created page XB-FEAT-22164454 (Created page with "=tff3.5= This is the Xenbase community wiki page for ''Xenopus ''tff3.5'' genes. Please feel free to record here any relevant information about these ones, that is not already represented on the gene page or elsewhere on Xenbase. =genome annotation notes= 12DEC2023 note that ''tff3.5.S'' is not annoatated on the ''X. laevis'' v10 genome release. We looked, and couldn't find a v10.1 model for it.")
- 10:21, 11 December 2023 Xenbase talk contribs created page XB-FEAT-29084766 (Created page with " =protein= uncharacterized protein '''LOC101730711''' [Xenopus tropicalis] NCBI Reference Sequence: XP_017952313.2 >XP_017952313.2 uncharacterized protein LOC101730711 [Xenopus tropicalis] MCHILIFILLFLFLFQRKICEGRGRLSCPAVMGPARLHPFIILLGLFHLFLSSTSAVKVENFTLFEEKLK LEAHTANMIPCVFHTRRRLNPLRVQLEWGKMDKEGYVPLIHLDGNHVRKAAADFGDKYQLFIPQVSQGNC SLVINPMDIADSGTYQVRLRILGKLYEPVPSIEIQVVDQRKVESRAWGKKKTTVPPTTIATVPPGFVDDV QKRLVKIDKMAIIAIILNGVFVGIAILLGVLVFITYRKKSSSGDEENPPKKRKQKGKKEPSDESEESSSS...")
- 10:34, 5 December 2023 Xenbase talk contribs created page XB-FEAT-22169226 (Created page with "=''chst9l.2''=")
- 13:46, 4 December 2023 Xenbase talk contribs created page XB-FEAT-29078026 (Created page with "=''chst1l''= =protein > homology group> nomenclature notes= 12.04.2023 protein: carbohydrate sulfotransferase 1 [Xenopus laevis] NCBI Reference Sequence: XP_018107451.1 >XP_018107451.1 carbohydrate sulfotransferase 1 [Xenopus laevis] MECSWKAVVLLVFASLGIQYTAIKSLRTAFKSPCQVMGGESRCFQRDLRDNASRLLCEDLGQVNRKHIIL LATTRSGSSFLGQIFNQNPDIFYLYEPLYHVQRAFTNSSTRMQKQIDRRSLLGAYRDLLHNLYNCDFYFL ENYLRPAPKDHETTSFFRRGASNALCLPPVCEQLHPIEEHLCSKKCRTVNLTLVSKSCHQYKHMAIKTVR IPEINDIRTLVEDPRLNLKVIH...")
- 07:46, 30 November 2023 Xenbase talk contribs created page File:Six6 synteny.png
- 07:46, 30 November 2023 Xenbase talk contribs uploaded File:Six6 synteny.png
- 14:12, 18 October 2023 Xenbase talk contribs created page File:Screenshot 2023-10-18 at 4.10.09 PM.png
- 14:12, 18 October 2023 Xenbase talk contribs uploaded File:Screenshot 2023-10-18 at 4.10.09 PM.png
- 13:38, 18 October 2023 Xenbase talk contribs created page XB-FEAT-18034121 (Created page with "=''rho.2''= This is the community wiki page for the ''Xenopus rho.2'' genes. Please add here any relevant information pertaining to these genes, if it is not represented elsewhere on Xenbase. =annotation and synteny= Note that this gene is a duplicate of the adjacent ''rho'' gene, on Chromosome 4, but is only seen in ''X. laeivs'' L subgenome. In v10 assemblies: ''Xtr.chr4: mbd4< ift122> rho> h1-8> plxnd1<'' ''Xla.4L:mbd4.L< ift122.L> rho.L> '''rho.2.L>''' h1-8.L>...")
- 12:00, 18 October 2023 Xenbase talk contribs created page XB-FEAT-22065720 (Created page with "=opn7a= =summary from NCBI= Predicted to enable G protein-coupled receptor activity and photoreceptor activity. Acts upstream of or within phototransduction. Predicted to be located in membrane. Predicted to be integral component of membrane. Is expressed in several structures, including brain; digestive system; eye; heart; and testis. [provided by Alliance of Genome Resources, Apr 2022]")
- 13:01, 17 October 2023 Xenbase talk contribs created page XB-FEAT-29083966 (Created page with "= opn6bl= This is the Xenbase wiki page for the Xenopus genes 'opn6bl''. Fee; free to record anything here about these genes a=thata are not recorded elsewhere on Xenbase. =nomenclature changes= 18OCT2023 The gene symbol and names for the opsin gens where updated, provisionally, replacing the ''LOC 100497987, visual pigment-like receptor peropsin'' with ''opn6bl, visual pigment-like receptor peropsin 6b like'', which combines the X.tropicalis gene /protein name with th...")
- 08:03, 10 October 2023 Xenbase talk contribs created page XB-FEAT-22063928 (Created page with "=''notch4''= This is the community wiki page for the gene ''notch4'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase. =gene nomenclature and annotation notes= In ''X. laevis'', on chromosome 8L, LOC121397048 is the gene next to ''tap2.L'' and we propose that represents a non-coding fragment of ''notch4''. This annotation was based on BLAST of notch4.S XM_041575228.1, which identified the loci n...")
- 14:49, 9 October 2023 Xenbase talk contribs created page File:Undefined-4.pdf
- 14:49, 9 October 2023 Xenbase talk contribs uploaded File:Undefined-4.pdf
- 14:48, 9 October 2023 Xenbase talk contribs created page File:Undefined-3.pdf
- 14:48, 9 October 2023 Xenbase talk contribs uploaded File:Undefined-3.pdf
- 13:02, 9 October 2023 Xenbase talk contribs created page XB-FEAT-22062677 (Created page with "=''cx38''= This is the community wiki page for the gene ''cx38'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase. =nomenclature= 09 OCTOBER 2023 Note: no other vertebrate genes are called ''cx38'', just ''X. trop'' GeneID:100170463, and ''X. laevis'' GeneID:397866. The Synonym given is ''gja2'', which in NCBI is currently only assigned to genes in a large number of fish species, but no other vert...")
- 15:14, 5 October 2023 Xenbase talk contribs created page File:Stage44ventral.jpg