User contributions for Christina
Jump to navigation
Jump to search
15 December 2023
- 20:2320:23, 15 December 2023 diff hist +1 XB-FEAT-29099462 →nomenclature current
- 20:2320:23, 15 December 2023 diff hist +452 N XB-FEAT-29099462 Created page with "=smim38= This is the community wiki page for the gene ''smim38'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase =nomenclature= 15DEC2023 The ''X. laevis'' L gene previously annotated as ''LOC121402925.L'' (Xenbase v10 gene model XBXL10_1g17811) is determined to be the L homeolog of the ''smim38'' gene, due to synteny and sequence similarity with ''X. tropicalis'' ''smim38''."
29 November 2023
- 13:3713:37, 29 November 2023 diff hist 0 XB-FEAT-975698 No edit summary current
- 13:3213:32, 29 November 2023 diff hist +602 XB-FEAT-975698 →pcbd1
20 November 2023
- 11:3311:33, 20 November 2023 diff hist +182 XB-FEAT-995002 →nomenclature changes current
- 11:3211:32, 20 November 2023 diff hist +623 XB-FEAT-995002 →nomenclature changes
9 November 2023
- 23:2823:28, 9 November 2023 diff hist +74 m XB-FEAT-5900919 →summary of gene function current
- 23:2623:26, 9 November 2023 diff hist 0 XB-FEAT-5900919 →summery of gene function
- 23:2623:26, 9 November 2023 diff hist +609 XB-FEAT-5900919 →jhdm1d
6 November 2023
- 10:2710:27, 6 November 2023 diff hist 0 XB-FEAT-6035520 →nomenclature changes current
- 10:2610:26, 6 November 2023 diff hist +155 XB-FEAT-6035520 →nomenclature changes
30 October 2023
- 18:2318:23, 30 October 2023 diff hist +40 XB-FEAT-6035520 →nomenclature changes
- 18:2218:22, 30 October 2023 diff hist −14 XB-FEAT-6035520 →wi2-2373i1.2
- 18:2218:22, 30 October 2023 diff hist +503 XB-FEAT-6035520 →foxl3
13 September 2023
- 14:1014:10, 13 September 2023 diff hist +27 XB-FEAT-5734493 →Synteny pattern current
- 14:0414:04, 13 September 2023 diff hist 0 XB-FEAT-5734493 →rasefl
- 14:0414:04, 13 September 2023 diff hist +962 XB-FEAT-5734493 →nomenclature changes
12 September 2023
- 12:4212:42, 12 September 2023 diff hist +363 XB-FEAT-23659672 →cxcl8b current
- 12:3912:39, 12 September 2023 diff hist +12 N XB-FEAT-23659672 Created page with "=''cxcl8b''="
- 12:2512:25, 12 September 2023 diff hist +609 XB-FEAT-29208828 →il18.2 current
- 12:1812:18, 12 September 2023 diff hist +190 N XB-FEAT-29208828 Created page with "=''il18.2''= This is the community wiki page for the gene ''il18.2'' please feel free to add any information that is relevant to this gene that is not already captured elsewh..."
- 12:1512:15, 12 September 2023 diff hist +12 XB-FEAT-876700 →synteny pattern current
- 12:1512:15, 12 September 2023 diff hist +1 XB-FEAT-876700 →nomenclature changes
- 12:1312:13, 12 September 2023 diff hist +721 XB-FEAT-876700 →il18
- 09:4009:40, 12 September 2023 diff hist +6 XB-FEAT-5937786 →nomenclature changes current
- 09:3509:35, 12 September 2023 diff hist +4 XB-FEAT-488038 →shh current
- 09:3409:34, 12 September 2023 diff hist +191 N XB-FEAT-6460977 Created page with "=''il22ra1''= This is the community wiki page for the gene ''il22ra1'' please feel free to add any information that is relevant to this gene that is not already captured elsew..." current
11 September 2023
- 10:1110:11, 11 September 2023 diff hist +230 XB-FEAT-22201451 →flt3lg current
- 10:0710:07, 11 September 2023 diff hist +4 XB-FEAT-22201451 →flt3lg
- 10:0610:06, 11 September 2023 diff hist +187 N XB-FEAT-22201451 Created page with "= flt3lg = This is the community wiki page for the gene ''flt3lg'' please feel free to add any information that is relevant to this gene that is not already captured elsewher..."
9 September 2023
- 04:5504:55, 9 September 2023 diff hist +490 XB-FEAT-1005401 →mthfr current
8 September 2023
- 10:0210:02, 8 September 2023 diff hist +4 XB-FEAT-854080 →foxm1 current
22 August 2023
- 14:5614:56, 22 August 2023 diff hist +494 XB-FEAT-5850668 →unnamed current
- 07:4107:41, 22 August 2023 diff hist +14 XB-FEAT-5846943 →summary from NCBI current
- 07:4107:41, 22 August 2023 diff hist +4 XB-FEAT-5846943 →ptk7
21 August 2023
- 16:4416:44, 21 August 2023 diff hist +4 XB-FEAT-969526 →zswim4 current
17 August 2023
- 08:3708:37, 17 August 2023 diff hist +97 XB-FEAT-22068404 →nomenclature changes current
- 08:3508:35, 17 August 2023 diff hist +236 XB-FEAT-952335 →hmgcll1
- 08:3008:30, 17 August 2023 diff hist +2 XB-FEAT-22068404 →'
- 08:2908:29, 17 August 2023 diff hist +561 N XB-FEAT-22068404 Created page with "=''''= This is the community wiki page for the gene ''vcf1'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in X..."
1 August 2023
- 10:5910:59, 1 August 2023 diff hist −2 XB-FEAT-958104 →loc100489189 current
- 10:5810:58, 1 August 2023 diff hist +543 XB-FEAT-958104 →Nomenclature changes
- 10:4710:47, 1 August 2023 diff hist −8 XB-FEAT-940101 →loc100492522 current
- 10:4610:46, 1 August 2023 diff hist +199 XB-FEAT-940101 →Nomenclature changes
- 10:3910:39, 1 August 2023 diff hist +311 XB-FEAT-5879808 →loc100493626 current
- 10:3210:32, 1 August 2023 diff hist +6 XB-FEAT-920140 →annotation notes current
- 10:3110:31, 1 August 2023 diff hist 0 XB-FEAT-920140 →nomenclature updates
- 10:3110:31, 1 August 2023 diff hist 0 XB-FEAT-920140 →vmn2r26.2
- 10:2810:28, 1 August 2023 diff hist +97 XB-FEAT-920140 →nomenclature updates
- 10:2610:26, 1 August 2023 diff hist +296 XB-FEAT-920140 →loc297590
31 July 2023
- 14:2214:22, 31 July 2023 diff hist +4 XB-FEAT-6030634 →pnma1 current
28 July 2023
- 16:0016:00, 28 July 2023 diff hist +2 XB-FEAT-29208203 →orthology current
- 15:5915:59, 28 July 2023 diff hist +298 XB-FEAT-29208203 →nomenclature changes
- 15:5515:55, 28 July 2023 diff hist +10 XB-FEAT-22172606 →nomenclature changes current
- 15:5315:53, 28 July 2023 diff hist +4 XB-FEAT-22172606 →spata18a
- 15:3215:32, 28 July 2023 diff hist +52 XB-FEAT-22066202 →nomenclature changes current
- 15:1915:19, 28 July 2023 diff hist +285 XB-FEAT-6467132 →nomenclature changes
- 15:1415:14, 28 July 2023 diff hist +4 XB-FEAT-6467132 →ces3.5
- 15:0915:09, 28 July 2023 diff hist +189 XB-FEAT-488139 →nomenclature changes current
- 15:0815:08, 28 July 2023 diff hist −2 XB-FEAT-488139 →ocm1
- 15:0615:06, 28 July 2023 diff hist 0 XB-FEAT-488139 →nomenclature changes
- 14:3114:31, 28 July 2023 diff hist +4 XB-FEAT-5924997 →tuba1c.1 current
- 13:0613:06, 28 July 2023 diff hist +1,002 XB-FEAT-5758460 →or51e1 current
- 12:5312:53, 28 July 2023 diff hist +2 XB-FEAT-6462861 →protein alignment current
- 12:5312:53, 28 July 2023 diff hist +147 XB-FEAT-6462861 →nomenclature changes
- 12:4012:40, 28 July 2023 diff hist +109 XB-FEAT-482447 →nomenclature changes current
- 12:1812:18, 28 July 2023 diff hist +185 XB-FEAT-856224 →cby1 current
- 12:1712:17, 28 July 2023 diff hist +184 XB-FEAT-486752 →ddah2 current
- 12:1312:13, 28 July 2023 diff hist +166 XB-FEAT-480368 →slbp current
27 July 2023
- 11:4411:44, 27 July 2023 diff hist +90 XB-FEAT-959133 →nomenclature changes current
26 July 2023
- 13:4713:47, 26 July 2023 diff hist +890 N XB-FEAT-29208211 Created page with "=''il17a.2''= =nomenclature changes= 27JULY2023 Three genes were annotated in the v10 assembly as ''il17a-like'' on the same section of Chromosome 5L. These have been provis..." current
- 13:3813:38, 26 July 2023 diff hist +433 N XB-FEAT-29208203 Created page with "=''il17a''= =nomenclature changes= Three genes were annotated in the v10 assembly as ''il17a-like'' on the same section of Chromosome 5L. These have been provisionally given..."
- 13:2013:20, 26 July 2023 diff hist +393 N XB-FEAT-29208219 Created page with "=''il17a.3''= =nomenclature changes= Three''il17a'' genes were annotated as ''il17a-like'' omn Chromosome 5L/5S. in the ''X. laevis'' v10.1 annotation. These genes are now p..." current
- 10:0910:09, 26 July 2023 diff hist +203 XB-FEAT-481854 →il7r current
25 July 2023
- 09:0609:06, 25 July 2023 diff hist +24 XB-FEAT-6459080 →zswim9 current
- 09:0509:05, 25 July 2023 diff hist +1 XB-FEAT-6459080 →zswim9
- 09:0509:05, 25 July 2023 diff hist +273 XB-FEAT-6459080 →zswim9
14 July 2023
- 11:5011:50, 14 July 2023 diff hist +333 XB-FEAT-950724 →Nomenclature changes current
- 11:3811:38, 14 July 2023 diff hist +4 XB-FEAT-950724 →abcb1l
- 11:3811:38, 14 July 2023 diff hist −11 XB-FEAT-950724 →loc100494740
- 11:2511:25, 14 July 2023 diff hist +4 XB-FEAT-22065613 No edit summary current
- 11:2411:24, 14 July 2023 diff hist +118 XB-FEAT-22065609 No edit summary current
- 11:2411:24, 14 July 2023 diff hist 0 XB-FEAT-5894692 →nomenlcature changes current
- 11:2411:24, 14 July 2023 diff hist +172 XB-FEAT-5894692 →nomenlcature changes
- 11:2111:21, 14 July 2023 diff hist +113 XB-FEAT-22065613 No edit summary
- 11:0411:04, 14 July 2023 diff hist +2 XB-FEAT-22063306 →btn1a1 current
- 11:0211:02, 14 July 2023 diff hist +4 XB-FEAT-5867804 →btn1a1 current
- 10:4910:49, 14 July 2023 diff hist +515 XB-FEAT-29079666 →btnl10 current
- 10:4410:44, 14 July 2023 diff hist +192 N XB-FEAT-29079666 Created page with "=''btnl10'' = This is the community wiki page for the gene ''btnl10'' please feel free to add any information that is relevant to this gene that is not already captured else..."
- 10:3710:37, 14 July 2023 diff hist +4 XB-FEAT-5894678 →btnl10.2 current
- 10:3510:35, 14 July 2023 diff hist −22 XB-FEAT-5894678 →nomenclature updates
- 10:3310:33, 14 July 2023 diff hist −42 XB-FEAT-5894678 →XB5894678 [provisional:btnl10]
- 10:2810:28, 14 July 2023 diff hist −2 XB-FEAT-22172574 →notes on synteny current
- 10:1510:15, 14 July 2023 diff hist +3 XB-FEAT-22172598 →guca1b current
- 10:1410:14, 14 July 2023 diff hist +56 XB-FEAT-959836 →orthology current
- 10:0810:08, 14 July 2023 diff hist +70 XB-FEAT-983103 →gene models current
- 10:0510:05, 14 July 2023 diff hist +147 XB-FEAT-959836 →orthology
- 10:0010:00, 14 July 2023 diff hist −33 XB-FEAT-959836 →protein accession
- 10:0010:00, 14 July 2023 diff hist −7 XB-FEAT-959836 →loc100489506
- 09:5909:59, 14 July 2023 diff hist +1,106 XB-FEAT-959836 →Nomenclature changes
- 09:2809:28, 14 July 2023 diff hist +73 XB-FEAT-990942 →gene models current
- 09:2809:28, 14 July 2023 diff hist +5 XB-FEAT-990942 →kcnh6
- 09:1709:17, 14 July 2023 diff hist +5 XB-FEAT-983103 →kcnh2
- 08:4208:42, 14 July 2023 diff hist +820 N XB-FEAT-29081262 Created page with "=''ctss.4''= This is the community wiki page for the ''Xenopus ctss.4'' genes. Please feel free to add any information here, that is relevant to these genes and is not already..." current
- 08:2308:23, 14 July 2023 diff hist +1,763 N XB-FEAT-29089970 Created page with "=''pkn2l.8''= This is the community wiki page for the ''Xenopus pkn2l.8'' genes. Please feel free to add any information here, that is relevant to these genes and is not alrea..." current
- 07:5707:57, 14 July 2023 diff hist +880 N XB-FEAT-29087614 Created page with "=''pkn2l.7''= This is the community wiki page for the ''Xenopus pkn2l.7'' genes. Please feel free to add any information here, that is relevant to these genes and is not alre..." current
- 07:4407:44, 14 July 2023 diff hist +33 XB-FEAT-29091126 →nomenclature changes current
- 07:4307:43, 14 July 2023 diff hist +166 XB-FEAT-29091126 →nomenclature changes
- 07:3407:34, 14 July 2023 diff hist +667 N XB-FEAT-29091126 Created page with " = ''stk38l2'' = This is the community wiki page for the ''Xenopus stk38l2'' genes. Please feel free to add any information here, that is relevant to these genes and is not al..."
- 07:2007:20, 14 July 2023 diff hist +593 N XB-FEAT-29089974 Created page with " =''pkn2l.6''= This is the community wiki page for the ''Xenopus pkn2l.6'' genes. Please feel free to add any information here, that is relevant to these genes and is not alre..." current
- 07:1607:16, 14 July 2023 diff hist −10 XB-FEAT-29085518 →nomenclature changes current
- 07:1007:10, 14 July 2023 diff hist +168 XB-FEAT-484952 →akt1 current
- 07:0907:09, 14 July 2023 diff hist +2,299 XB-FEAT-484952 →notes on gene function
- 07:0607:06, 14 July 2023 diff hist +2,711 N XB-FEAT-29089902 Created page with "=''akt1l''= This is the community wiki page for the ''Xenopus'' ''akt1l'' genes. Please feel free to add any information here, that is relevant to these genes and is not alrea..." current
13 July 2023
- 15:2315:23, 13 July 2023 diff hist +605 N XB-FEAT-29079534 Created page with "=''pkn2l.5''= This is the community wiki page for the ''Xenopus pkn2l.5'' genes. Please feel free to add any information here, that is relevant to these genes and is not alrea..." current
- 15:1615:16, 13 July 2023 diff hist +604 N XB-FEAT-29089978 Created page with "=''pkn2l.4''= This is the community wiki page for the Xenopus pkn2l.4 genes. Please feel free to add any information here, that is relevant to these genes and is not already c..." current
- 15:1315:13, 13 July 2023 diff hist −17 XB-FEAT-29079470 →nomenclature changes current
- 15:1015:10, 13 July 2023 diff hist +618 N XB-FEAT-29092170 Created page with "= '' pkn1l.2'' = This is the community wiki page for the '' Xenopus '' ''pkn1l.2'' genes. Please feel free to add any information here, that is relevant to these genes and..." current
- 15:0615:06, 13 July 2023 diff hist +2 XB-FEAT-29091846 →orthology current
- 15:0615:06, 13 July 2023 diff hist +611 N XB-FEAT-29091846 Created page with "= '' pkn1l'' = This is the community wiki page for the '' Xenopus '' ''pkn1l '' genes. Please feel free to add any information here, that is relevant to these genes and is..."
- 14:5714:57, 13 July 2023 diff hist +40 XB-FEAT-29079470 →nomenclature changes
- 14:5414:54, 13 July 2023 diff hist +584 N XB-FEAT-29079470 Created page with "=''pkn2l.3''= This is the community wiki page for the ''Xenopus'' ''pkn2l.3'' genes. Please feel free to add any information here, that is relevant to these genes and is not a..."
- 14:5214:52, 13 July 2023 diff hist +4 XB-FEAT-29091842 →orthology current
- 14:5114:51, 13 July 2023 diff hist 0 XB-FEAT-29091842 →orthology
- 14:5114:51, 13 July 2023 diff hist 0 XB-FEAT-29091842 →nomenclature changes
- 14:5114:51, 13 July 2023 diff hist −1 XB-FEAT-29091842 →pnk2l.2
- 14:5014:50, 13 July 2023 diff hist −1 XB-FEAT-29091842 →=orthology
- 14:5014:50, 13 July 2023 diff hist 0 XB-FEAT-29091842 →nomenclature chnages
- 14:4914:49, 13 July 2023 diff hist +616 N XB-FEAT-29091842 Created page with "= ''pnk2l.2'' = This is the community wiki page for the '' Xenopus' '' ''pnk2l.2'' genes. Please feel free to add any information here, that is relevant to these genes and..."
- 14:3914:39, 13 July 2023 diff hist +14 XB-FEAT-29085518 →nomenclature changes
- 14:3914:39, 13 July 2023 diff hist 0 XB-FEAT-29085518 →pkn2l
- 14:3814:38, 13 July 2023 diff hist +4 XB-FEAT-29085518 →pkn2l
- 14:3814:38, 13 July 2023 diff hist +630 N XB-FEAT-29085518 Created page with "= pkn2l = This is the community wiki page for the '' Xenopus '' ''pkn2l '' genes. Please feel free to add any information here, that is relevant to these genes and is not al..."
- 14:2814:28, 13 July 2023 diff hist +401 N XB-FEAT-29089986 Created page with "= '' ctss.3'' = This is the community wiki page for the '' Xenopus '' ''ctss.3'' genes. Please feel free to add any information here, that is relevant to these genes and is..." current
- 14:2014:20, 13 July 2023 diff hist +200 XB-FEAT-29098998 →protein sequence current
- 14:1414:14, 13 July 2023 diff hist +619 N XB-FEAT-29098998 Created page with " =protein sequence= XB used this protein accession to characterize this gene: >NP_001076821.2 uncharacterized protein LOC594890 precursor [Xenopus tropicalis] MGFYRQCLIGLFALL..."
- 14:0814:08, 13 July 2023 diff hist +4 XB-FEAT-986811 →ctsk.3 current
- 14:0714:07, 13 July 2023 diff hist +200 XB-FEAT-986811 →loc100490139
- 13:5513:55, 13 July 2023 diff hist +368 N XB-FEAT-29098938 Created page with " =gene nomenclature updates= 13 JULY 2023 ''Xenopus'' gene symbol changed from ''LOC448216'' to ''ctsk.2'' ''Xenopus'' gene from ''cathepsin K (pycnodysostosis)'' to ''cath..." current
- 13:4213:42, 13 July 2023 diff hist +467 N XB-FEAT-29098762 Created page with "=''rps6ka4l''= This is the community wiki page for the '' Xenopus '' ''rps6ka4l '' genes. Please feel free to add any information here, that is relevant to these genes but t..." current
- 13:2213:22, 13 July 2023 diff hist +548 N XB-FEAT-29098926 Created page with "=''ccnb5''= =nomenclature updates= 05JULY 2023 ''Xenopus'' gene symbol changed from ''LOC394448'' to ''ccnb5''. This change is supported by DIOPT/EggNog analaysis, which m..." current
- 06:5706:57, 13 July 2023 diff hist +295 XB-FEAT-5802730 →nomenclature updates current
- 06:5406:54, 13 July 2023 diff hist −46 XB-FEAT-5802730 →nomenclature changes
- 06:5406:54, 13 July 2023 diff hist +21 XB-FEAT-5802730 →XB5802730 provisional rab10l
11 July 2023
- 15:4815:48, 11 July 2023 diff hist +380 Protocols →Xenopus oocyte cell free extract
- 15:4315:43, 11 July 2023 diff hist +27 Protocols →Protocols published in non-CSHL Journals- click to view-
7 July 2023
- 06:3706:37, 7 July 2023 diff hist +147 XB-FEAT-946621 →nomenclature changes current
- 06:3606:36, 7 July 2023 diff hist −169 XB-FEAT-946621 →nomenclature changes
- 06:3606:36, 7 July 2023 diff hist +5 XB-FEAT-946621 →hif1a
5 July 2023
- 12:3912:39, 5 July 2023 diff hist 0 XB-FEAT-29071333 →atrx2 current
- 08:1808:18, 5 July 2023 diff hist +2 XB-FEAT-22065331 →nomenclature changes current
- 08:1708:17, 5 July 2023 diff hist +80 XB-FEAT-22065331 →nomenclature changes
- 07:4307:43, 5 July 2023 diff hist +209 XB-FEAT-493800 →larp6 current
1 July 2023
- 14:5814:58, 1 July 2023 diff hist −6 XB-FEAT-13579844 →c1h4orf48 current
30 June 2023
- 14:4014:40, 30 June 2023 diff hist +426 XB-FEAT-13579844 →nomenclature changes
- 14:2314:23, 30 June 2023 diff hist +180 XB-FEAT-5767696 →fam120a current
- 14:2114:21, 30 June 2023 diff hist +157 XB-FEAT-6037326 →fam120c current
- 14:1114:11, 30 June 2023 diff hist +180 XB-FEAT-980081 →fam120b current
- 14:0914:09, 30 June 2023 diff hist +176 XB-FEAT-494052 →tubgcp5 current
- 14:0314:03, 30 June 2023 diff hist +175 XB-FEAT-491695 →tubgcp4 current
- 13:5713:57, 30 June 2023 diff hist +174 XB-FEAT-490982 →tubgcp3 current
- 13:5113:51, 30 June 2023 diff hist +175 XB-FEAT-490605 →tubgcp6 current
- 13:4913:49, 30 June 2023 diff hist +168 XB-FEAT-490452 →tubgcp2 current
- 12:2912:29, 30 June 2023 diff hist +307 XB-FEAT-995201 →loc100158538 current
22 June 2023
- 12:1712:17, 22 June 2023 diff hist +4 XB-FEAT-992706 →nomenclature changes current
- 12:1612:16, 22 June 2023 diff hist +1,059 XB-FEAT-992706 →nomenclature changes
- 12:1012:10, 22 June 2023 diff hist +461 XB-FEAT-992706 →ca13
- 12:0212:02, 22 June 2023 diff hist +5 XB-FEAT-992706 →ca13
21 June 2023
- 12:1012:10, 21 June 2023 diff hist +182 XB-FEAT-981838 →exog current
- 11:2711:27, 21 June 2023 diff hist +5 XB-FEAT-5846793 →znf33b current
- 11:2011:20, 21 June 2023 diff hist +676 XB-FEAT-29087790 →RefSeq protein accession current
- 11:1011:10, 21 June 2023 diff hist +589 N XB-FEAT-29087790 Created page with "=RefSeq protein accession= >XP_031760301.1 gastrula zinc finger protein XlCGF26.1-like [Xenopus tropicalis] MRFCSTQNLLIHQRIHTGRSFVCSKCGKYFSHRKILIAHKWVHTGRKPFTCTESNKGFLWNRDLQQH..."
- 11:0811:08, 21 June 2023 diff hist +849 XB-FEAT-29077586 →refSeq protein accession current
- 11:0011:00, 21 June 2023 diff hist +747 N XB-FEAT-29077586 Created page with "=refSeq protein accession= XP_031760308.1 gastrula zinc finger protein XlCGF57.1-like isoform X1 [Xenopus tropicalis] MEINPVMTTVLQTNNNTMSGPTPVTSEVPIESPKTNQLSKGQRPGKPFVCAKCKRRF..."
- 10:5510:55, 21 June 2023 diff hist −1 XB-FEAT-29097482 →nomenclature changes current
- 10:5510:55, 21 June 2023 diff hist +687 N XB-FEAT-29097482 Created page with "=''znf33bl''= This is the community wiki page for ''Xenopus'' ''znf33bl'' genes. Please record here any relenat information that is not captured elsewhere on Xenbase. =nomenc..."
- 10:3810:38, 21 June 2023 diff hist +588 N XB-FEAT-29099066 Created page with "=''znf24l ''= This is the Xenbase wiki page for ''Xenopus '' ''znf24l'' genes. Please record here any relevant information about ''znf24l'' not captured elsewhere on Xenbase...." current
- 10:2710:27, 21 June 2023 diff hist +15 XB-FEAT-29091390 →nomenclature changes current
- 10:2610:26, 21 June 2023 diff hist +439 N XB-FEAT-29091390 Created page with "== =nomenclature changes= 20JUNE2023 ''Xenopus'' gene name changed from ''gastrula zinc finger protein XlCGF8.2DB-like'' to ''zinc finger and SCAN domain containing 32 like''..."
- 07:4007:40, 21 June 2023 diff hist +153 XB-FEAT-6046830 →padi4 current
- 07:3107:31, 21 June 2023 diff hist +155 XB-FEAT-996813 →padi2 current
20 June 2023
- 12:2112:21, 20 June 2023 diff hist +4 XB-FEAT-5789487 →ptgr1 current
- 12:2112:21, 20 June 2023 diff hist +10 XB-FEAT-5789487 →nomenclature updates
- 12:2012:20, 20 June 2023 diff hist −2 XB-FEAT-5789487 →ptgr1.1
17 June 2023
- 19:1319:13, 17 June 2023 diff hist +400 XB-FEAT-482447 →tdgf1
- 19:0919:09, 17 June 2023 diff hist +307 XB-FEAT-5995511 →nomenclature changes current
- 19:0419:04, 17 June 2023 diff hist +151 XB-FEAT-1217654 →bnc1 current
- 19:0119:01, 17 June 2023 diff hist +145 XB-FEAT-953156 →bnc2 current
- 18:5918:59, 17 June 2023 diff hist +135 XB-FEAT-920751 →shox current
- 18:5718:57, 17 June 2023 diff hist +138 XB-FEAT-480992 →shox2 current
16 June 2023
- 16:4416:44, 16 June 2023 diff hist +15 XB-FEAT-22063241 →nomenclature changes current
- 16:4416:44, 16 June 2023 diff hist +440 N XB-FEAT-22063241 Created page with "=nomenclature changes= 18JUNE2023 Gene name and symbol was updated from ''XB22063241 provisional ortholog of lymphocyte antigen 6 complex, locus A2'' to ''ly6g6e , lymphocyte..."
- 10:3310:33, 16 June 2023 diff hist +4 XB-FEAT-491910 →il17bl current
- 10:3310:33, 16 June 2023 diff hist +137 XB-FEAT-491910 →il17bl
- 08:1108:11, 16 June 2023 diff hist +1 XB-FEAT-29093310 →nomenclature changes current
- 08:1108:11, 16 June 2023 diff hist +385 N XB-FEAT-29093310 Created page with "=''or5as1''= This is the community wiki page for the ''Xenopus'' ''or5as1'' genes. Please feel free to record here anything relevant to this gene that is not recorded elsewher..."
15 June 2023
- 11:3911:39, 15 June 2023 diff hist +11 XB-FEAT-950176 →gene annotation corrections current
- 11:3511:35, 15 June 2023 diff hist +10 XB-FEAT-960657 →gene annotation corrections current
- 11:1611:16, 15 June 2023 diff hist +25 XB-FEAT-29077890 →cupin1.2 current
- 11:1411:14, 15 June 2023 diff hist +1,432 N XB-FEAT-29077890 Created page with "=cupin1.2= There's a complex evolutionary history of a set of genes including those previously called '''DYNAP''' in the region between C18orf54 and RAB27b. After review fro..."
- 10:5310:53, 15 June 2023 diff hist +20 XB-FEAT-5953480 →nomenclature changes and synteny current
- 10:4810:48, 15 June 2023 diff hist +1 XB-FEAT-29071321 →synteny patterns for INPPL1A/B in Vertebrates current
- 10:4810:48, 15 June 2023 diff hist +224 XB-FEAT-29071321 →synteny and orthology
- 10:4610:46, 15 June 2023 diff hist +3 XB-FEAT-29071321 →inppl1b
- 10:4510:45, 15 June 2023 diff hist +2,275 XB-FEAT-29071321 →inpp1b
- 09:5809:58, 15 June 2023 diff hist +106 XB-FEAT-988106 →adam33
13 June 2023
- 12:2312:23, 13 June 2023 diff hist +22 XB-FEAT-989872 →accs
- 12:2212:22, 13 June 2023 diff hist +682 XB-FEAT-989872 →nomenclature notes
9 June 2023
- 10:3010:30, 9 June 2023 diff hist −539 XB-FEAT-955111 →nomenclature changes current
- 10:3010:30, 9 June 2023 diff hist −14 XB-FEAT-955111 →LOC100496122
- 10:2710:27, 9 June 2023 diff hist 0 XB-FEAT-955111 →syt13
- 10:2610:26, 9 June 2023 diff hist 0 XB-FEAT-955111 →nomenclature changes
- 10:2310:23, 9 June 2023 diff hist −708 XB-FEAT-955111 →nomenclature changes
- 10:2010:20, 9 June 2023 diff hist +708 XB-FEAT-955111 →LOC100494466
- 10:1110:11, 9 June 2023 diff hist +584 XB-FEAT-955111 →syt13
8 June 2023
- 15:2015:20, 8 June 2023 diff hist +315 XB-FEAT-5924997 →NOMENCLATURE CHANGES
- 14:4514:45, 8 June 2023 diff hist +360 N XB-FEAT-22068128 Created page with "=''spmip4''= his is the community wiki page for the gene ''spmip4'' please feel free to add any information that is relevant to this gene that is not already captured elsewher..." current
- 14:4114:41, 8 June 2023 diff hist −191 XB-FEAT-5826965 →nomenclature changes
- 14:3914:39, 8 June 2023 diff hist −4 XB-FEAT-5826965 →LOC100290036
- 14:3114:31, 8 June 2023 diff hist +144 XB-FEAT-947876 →nomenclature changes current
- 14:2914:29, 8 June 2023 diff hist +371 XB-FEAT-1016706 →setd3 current
- 14:2614:26, 8 June 2023 diff hist +193 XB-FEAT-995589 →spo11 current
- 14:2514:25, 8 June 2023 diff hist +4 XB-FEAT-952801 →mettl16 current
- 14:2414:24, 8 June 2023 diff hist +149 XB-FEAT-952801 →nomenclature changes
- 14:2314:23, 8 June 2023 diff hist +155 XB-FEAT-5811218 →nomenclature updates current
- 14:2114:21, 8 June 2023 diff hist +145 XB-FEAT-5809154 →nomenclature changes current
- 14:2014:20, 8 June 2023 diff hist +161 XB-FEAT-5749472 →nomenclature updates current
- 14:1814:18, 8 June 2023 diff hist +4 XB-FEAT-1219056 →zfyve28a current
- 14:1714:17, 8 June 2023 diff hist +4 XB-FEAT-965487 →mettl13 current
- 14:1614:16, 8 June 2023 diff hist +213 XB-FEAT-965487 →nomenclature changes
- 13:4913:49, 8 June 2023 diff hist +8 XB-FEAT-29071333 →Xenopus artx genes
- 13:4813:48, 8 June 2023 diff hist −20 XB-FEAT-29071333 →synteny patterns
- 13:4713:47, 8 June 2023 diff hist +114 XB-FEAT-29071333 →Xenopus artx genes
- 13:4613:46, 8 June 2023 diff hist −1 XB-FEAT-29071333 →atrx2
- 13:4613:46, 8 June 2023 diff hist +1,149 XB-FEAT-29071333 →Xenopus artx genes
- 13:3113:31, 8 June 2023 diff hist −2 XB-FEAT-29071333 →Xenopus artx genes
- 13:1613:16, 8 June 2023 diff hist +596 XB-FEAT-29071333 →atrx2
- 13:0513:05, 8 June 2023 diff hist +11 N XB-FEAT-29071333 Created page with "=''atrx2''="
- 10:5910:59, 8 June 2023 diff hist +3 XB-FEAT-22065335 →Synteny in Xenopus current
- 10:5910:59, 8 June 2023 diff hist −10 XB-FEAT-22065335 →Synteny in Xenopus
- 10:5810:58, 8 June 2023 diff hist +494 XB-FEAT-22065335 →Synteny in Xenopus
- 10:5610:56, 8 June 2023 diff hist +245 XB-FEAT-22065335 →nomenclature and orthology notes
- 10:5210:52, 8 June 2023 diff hist +19 XB-FEAT-22065335 →nomenclature and orthology notes
- 10:5210:52, 8 June 2023 diff hist +114 XB-FEAT-22065335 →Synteny in Xenopus
- 10:5010:50, 8 June 2023 diff hist −2 XB-FEAT-22065335 →Synteny in Xenopus
- 10:4910:49, 8 June 2023 diff hist +329 XB-FEAT-22065335 →Synteny in Xenopus
- 10:4510:45, 8 June 2023 diff hist +110 XB-FEAT-22065335 →Synteny in Xenopus
- 10:3910:39, 8 June 2023 diff hist +137 XB-FEAT-22065335 No edit summary
- 10:3410:34, 8 June 2023 diff hist +715 XB-FEAT-22065335 →nomenclature and orthology notes
- 10:2910:29, 8 June 2023 diff hist 0 XB-FEAT-22065335 →mypopl1