User contributions for Christina
Jump to navigation
Jump to search
15 December 2023
- 20:2320:23, 15 December 2023 diff hist +1 XB-FEAT-29099462 →nomenclature current
- 20:2320:23, 15 December 2023 diff hist +452 N XB-FEAT-29099462 Created page with "=smim38= This is the community wiki page for the gene ''smim38'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase =nomenclature= 15DEC2023 The ''X. laevis'' L gene previously annotated as ''LOC121402925.L'' (Xenbase v10 gene model XBXL10_1g17811) is determined to be the L homeolog of the ''smim38'' gene, due to synteny and sequence similarity with ''X. tropicalis'' ''smim38''."
29 November 2023
- 13:3713:37, 29 November 2023 diff hist 0 XB-FEAT-975698 No edit summary current
- 13:3213:32, 29 November 2023 diff hist +602 XB-FEAT-975698 →pcbd1
20 November 2023
- 11:3311:33, 20 November 2023 diff hist +182 XB-FEAT-995002 →nomenclature changes current
- 11:3211:32, 20 November 2023 diff hist +623 XB-FEAT-995002 →nomenclature changes
9 November 2023
- 23:2823:28, 9 November 2023 diff hist +74 m XB-FEAT-5900919 →summary of gene function current
- 23:2623:26, 9 November 2023 diff hist 0 XB-FEAT-5900919 →summery of gene function
- 23:2623:26, 9 November 2023 diff hist +609 XB-FEAT-5900919 →jhdm1d
6 November 2023
- 10:2710:27, 6 November 2023 diff hist 0 XB-FEAT-6035520 →nomenclature changes current
- 10:2610:26, 6 November 2023 diff hist +155 XB-FEAT-6035520 →nomenclature changes
30 October 2023
- 18:2318:23, 30 October 2023 diff hist +40 XB-FEAT-6035520 →nomenclature changes
- 18:2218:22, 30 October 2023 diff hist −14 XB-FEAT-6035520 →wi2-2373i1.2
- 18:2218:22, 30 October 2023 diff hist +503 XB-FEAT-6035520 →foxl3
13 September 2023
- 14:1014:10, 13 September 2023 diff hist +27 XB-FEAT-5734493 →Synteny pattern current
- 14:0414:04, 13 September 2023 diff hist 0 XB-FEAT-5734493 →rasefl
- 14:0414:04, 13 September 2023 diff hist +962 XB-FEAT-5734493 →nomenclature changes
12 September 2023
- 12:4212:42, 12 September 2023 diff hist +363 XB-FEAT-23659672 →cxcl8b current
- 12:3912:39, 12 September 2023 diff hist +12 N XB-FEAT-23659672 Created page with "=''cxcl8b''="
- 12:2512:25, 12 September 2023 diff hist +609 XB-FEAT-29208828 →il18.2 current
- 12:1812:18, 12 September 2023 diff hist +190 N XB-FEAT-29208828 Created page with "=''il18.2''= This is the community wiki page for the gene ''il18.2'' please feel free to add any information that is relevant to this gene that is not already captured elsewh..."
- 12:1512:15, 12 September 2023 diff hist +12 XB-FEAT-876700 →synteny pattern current
- 12:1512:15, 12 September 2023 diff hist +1 XB-FEAT-876700 →nomenclature changes
- 12:1312:13, 12 September 2023 diff hist +721 XB-FEAT-876700 →il18
- 09:4009:40, 12 September 2023 diff hist +6 XB-FEAT-5937786 →nomenclature changes current
- 09:3509:35, 12 September 2023 diff hist +4 XB-FEAT-488038 →shh current
- 09:3409:34, 12 September 2023 diff hist +191 N XB-FEAT-6460977 Created page with "=''il22ra1''= This is the community wiki page for the gene ''il22ra1'' please feel free to add any information that is relevant to this gene that is not already captured elsew..." current
11 September 2023
- 10:1110:11, 11 September 2023 diff hist +230 XB-FEAT-22201451 →flt3lg current
- 10:0710:07, 11 September 2023 diff hist +4 XB-FEAT-22201451 →flt3lg
- 10:0610:06, 11 September 2023 diff hist +187 N XB-FEAT-22201451 Created page with "= flt3lg = This is the community wiki page for the gene ''flt3lg'' please feel free to add any information that is relevant to this gene that is not already captured elsewher..."
9 September 2023
- 04:5504:55, 9 September 2023 diff hist +490 XB-FEAT-1005401 →mthfr current
8 September 2023
- 10:0210:02, 8 September 2023 diff hist +4 XB-FEAT-854080 →foxm1 current
22 August 2023
- 14:5614:56, 22 August 2023 diff hist +494 XB-FEAT-5850668 →unnamed current
- 07:4107:41, 22 August 2023 diff hist +14 XB-FEAT-5846943 →summary from NCBI current
- 07:4107:41, 22 August 2023 diff hist +4 XB-FEAT-5846943 →ptk7
21 August 2023
- 16:4416:44, 21 August 2023 diff hist +4 XB-FEAT-969526 →zswim4 current
17 August 2023
- 08:3708:37, 17 August 2023 diff hist +97 XB-FEAT-22068404 →nomenclature changes current
- 08:3508:35, 17 August 2023 diff hist +236 XB-FEAT-952335 →hmgcll1
- 08:3008:30, 17 August 2023 diff hist +2 XB-FEAT-22068404 →'
- 08:2908:29, 17 August 2023 diff hist +561 N XB-FEAT-22068404 Created page with "=''''= This is the community wiki page for the gene ''vcf1'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in X..."
1 August 2023
- 10:5910:59, 1 August 2023 diff hist −2 XB-FEAT-958104 →loc100489189 current
- 10:5810:58, 1 August 2023 diff hist +543 XB-FEAT-958104 →Nomenclature changes
- 10:4710:47, 1 August 2023 diff hist −8 XB-FEAT-940101 →loc100492522 current
- 10:4610:46, 1 August 2023 diff hist +199 XB-FEAT-940101 →Nomenclature changes
- 10:3910:39, 1 August 2023 diff hist +311 XB-FEAT-5879808 →loc100493626 current
- 10:3210:32, 1 August 2023 diff hist +6 XB-FEAT-920140 →annotation notes current
- 10:3110:31, 1 August 2023 diff hist 0 XB-FEAT-920140 →nomenclature updates
- 10:3110:31, 1 August 2023 diff hist 0 XB-FEAT-920140 →vmn2r26.2
- 10:2810:28, 1 August 2023 diff hist +97 XB-FEAT-920140 →nomenclature updates
- 10:2610:26, 1 August 2023 diff hist +296 XB-FEAT-920140 →loc297590
31 July 2023
- 14:2214:22, 31 July 2023 diff hist +4 XB-FEAT-6030634 →pnma1 current
28 July 2023
- 16:0016:00, 28 July 2023 diff hist +2 XB-FEAT-29208203 →orthology current
- 15:5915:59, 28 July 2023 diff hist +298 XB-FEAT-29208203 →nomenclature changes
- 15:5515:55, 28 July 2023 diff hist +10 XB-FEAT-22172606 →nomenclature changes current
- 15:5315:53, 28 July 2023 diff hist +4 XB-FEAT-22172606 →spata18a
- 15:3215:32, 28 July 2023 diff hist +52 XB-FEAT-22066202 →nomenclature changes current
- 15:1915:19, 28 July 2023 diff hist +285 XB-FEAT-6467132 →nomenclature changes
- 15:1415:14, 28 July 2023 diff hist +4 XB-FEAT-6467132 →ces3.5
- 15:0915:09, 28 July 2023 diff hist +189 XB-FEAT-488139 →nomenclature changes current
- 15:0815:08, 28 July 2023 diff hist −2 XB-FEAT-488139 →ocm1
- 15:0615:06, 28 July 2023 diff hist 0 XB-FEAT-488139 →nomenclature changes
- 14:3114:31, 28 July 2023 diff hist +4 XB-FEAT-5924997 →tuba1c.1 current
- 13:0613:06, 28 July 2023 diff hist +1,002 XB-FEAT-5758460 →or51e1 current
- 12:5312:53, 28 July 2023 diff hist +2 XB-FEAT-6462861 →protein alignment current
- 12:5312:53, 28 July 2023 diff hist +147 XB-FEAT-6462861 →nomenclature changes
- 12:4012:40, 28 July 2023 diff hist +109 XB-FEAT-482447 →nomenclature changes current
- 12:1812:18, 28 July 2023 diff hist +185 XB-FEAT-856224 →cby1 current
- 12:1712:17, 28 July 2023 diff hist +184 XB-FEAT-486752 →ddah2 current
- 12:1312:13, 28 July 2023 diff hist +166 XB-FEAT-480368 →slbp current
27 July 2023
- 11:4411:44, 27 July 2023 diff hist +90 XB-FEAT-959133 →nomenclature changes current
26 July 2023
- 13:4713:47, 26 July 2023 diff hist +890 N XB-FEAT-29208211 Created page with "=''il17a.2''= =nomenclature changes= 27JULY2023 Three genes were annotated in the v10 assembly as ''il17a-like'' on the same section of Chromosome 5L. These have been provis..." current
- 13:3813:38, 26 July 2023 diff hist +433 N XB-FEAT-29208203 Created page with "=''il17a''= =nomenclature changes= Three genes were annotated in the v10 assembly as ''il17a-like'' on the same section of Chromosome 5L. These have been provisionally given..."
- 13:2013:20, 26 July 2023 diff hist +393 N XB-FEAT-29208219 Created page with "=''il17a.3''= =nomenclature changes= Three''il17a'' genes were annotated as ''il17a-like'' omn Chromosome 5L/5S. in the ''X. laevis'' v10.1 annotation. These genes are now p..." current
- 10:0910:09, 26 July 2023 diff hist +203 XB-FEAT-481854 →il7r current
25 July 2023
- 09:0609:06, 25 July 2023 diff hist +24 XB-FEAT-6459080 →zswim9 current
- 09:0509:05, 25 July 2023 diff hist +1 XB-FEAT-6459080 →zswim9
- 09:0509:05, 25 July 2023 diff hist +273 XB-FEAT-6459080 →zswim9
14 July 2023
- 11:5011:50, 14 July 2023 diff hist +333 XB-FEAT-950724 →Nomenclature changes current
- 11:3811:38, 14 July 2023 diff hist +4 XB-FEAT-950724 →abcb1l
- 11:3811:38, 14 July 2023 diff hist −11 XB-FEAT-950724 →loc100494740
- 11:2511:25, 14 July 2023 diff hist +4 XB-FEAT-22065613 No edit summary current
- 11:2411:24, 14 July 2023 diff hist +118 XB-FEAT-22065609 No edit summary current
- 11:2411:24, 14 July 2023 diff hist 0 XB-FEAT-5894692 →nomenlcature changes current
- 11:2411:24, 14 July 2023 diff hist +172 XB-FEAT-5894692 →nomenlcature changes
- 11:2111:21, 14 July 2023 diff hist +113 XB-FEAT-22065613 No edit summary
- 11:0411:04, 14 July 2023 diff hist +2 XB-FEAT-22063306 →btn1a1 current
- 11:0211:02, 14 July 2023 diff hist +4 XB-FEAT-5867804 →btn1a1 current
- 10:4910:49, 14 July 2023 diff hist +515 XB-FEAT-29079666 →btnl10 current
- 10:4410:44, 14 July 2023 diff hist +192 N XB-FEAT-29079666 Created page with "=''btnl10'' = This is the community wiki page for the gene ''btnl10'' please feel free to add any information that is relevant to this gene that is not already captured else..."
- 10:3710:37, 14 July 2023 diff hist +4 XB-FEAT-5894678 →btnl10.2 current
- 10:3510:35, 14 July 2023 diff hist −22 XB-FEAT-5894678 →nomenclature updates
- 10:3310:33, 14 July 2023 diff hist −42 XB-FEAT-5894678 →XB5894678 [provisional:btnl10]
- 10:2810:28, 14 July 2023 diff hist −2 XB-FEAT-22172574 →notes on synteny current
- 10:1510:15, 14 July 2023 diff hist +3 XB-FEAT-22172598 →guca1b current
- 10:1410:14, 14 July 2023 diff hist +56 XB-FEAT-959836 →orthology current
- 10:0810:08, 14 July 2023 diff hist +70 XB-FEAT-983103 →gene models current
- 10:0510:05, 14 July 2023 diff hist +147 XB-FEAT-959836 →orthology
- 10:0010:00, 14 July 2023 diff hist −33 XB-FEAT-959836 →protein accession
- 10:0010:00, 14 July 2023 diff hist −7 XB-FEAT-959836 →loc100489506
- 09:5909:59, 14 July 2023 diff hist +1,106 XB-FEAT-959836 →Nomenclature changes
- 09:2809:28, 14 July 2023 diff hist +73 XB-FEAT-990942 →gene models current
- 09:2809:28, 14 July 2023 diff hist +5 XB-FEAT-990942 →kcnh6
- 09:1709:17, 14 July 2023 diff hist +5 XB-FEAT-983103 →kcnh2
- 08:4208:42, 14 July 2023 diff hist +820 N XB-FEAT-29081262 Created page with "=''ctss.4''= This is the community wiki page for the ''Xenopus ctss.4'' genes. Please feel free to add any information here, that is relevant to these genes and is not already..." current
- 08:2308:23, 14 July 2023 diff hist +1,763 N XB-FEAT-29089970 Created page with "=''pkn2l.8''= This is the community wiki page for the ''Xenopus pkn2l.8'' genes. Please feel free to add any information here, that is relevant to these genes and is not alrea..." current
- 07:5707:57, 14 July 2023 diff hist +880 N XB-FEAT-29087614 Created page with "=''pkn2l.7''= This is the community wiki page for the ''Xenopus pkn2l.7'' genes. Please feel free to add any information here, that is relevant to these genes and is not alre..." current
- 07:4407:44, 14 July 2023 diff hist +33 XB-FEAT-29091126 →nomenclature changes current
- 07:4307:43, 14 July 2023 diff hist +166 XB-FEAT-29091126 →nomenclature changes
- 07:3407:34, 14 July 2023 diff hist +667 N XB-FEAT-29091126 Created page with " = ''stk38l2'' = This is the community wiki page for the ''Xenopus stk38l2'' genes. Please feel free to add any information here, that is relevant to these genes and is not al..."
- 07:2007:20, 14 July 2023 diff hist +593 N XB-FEAT-29089974 Created page with " =''pkn2l.6''= This is the community wiki page for the ''Xenopus pkn2l.6'' genes. Please feel free to add any information here, that is relevant to these genes and is not alre..." current
- 07:1607:16, 14 July 2023 diff hist −10 XB-FEAT-29085518 →nomenclature changes current
- 07:1007:10, 14 July 2023 diff hist +168 XB-FEAT-484952 →akt1 current
- 07:0907:09, 14 July 2023 diff hist +2,299 XB-FEAT-484952 →notes on gene function
- 07:0607:06, 14 July 2023 diff hist +2,711 N XB-FEAT-29089902 Created page with "=''akt1l''= This is the community wiki page for the ''Xenopus'' ''akt1l'' genes. Please feel free to add any information here, that is relevant to these genes and is not alrea..." current
13 July 2023
- 15:2315:23, 13 July 2023 diff hist +605 N XB-FEAT-29079534 Created page with "=''pkn2l.5''= This is the community wiki page for the ''Xenopus pkn2l.5'' genes. Please feel free to add any information here, that is relevant to these genes and is not alrea..." current
- 15:1615:16, 13 July 2023 diff hist +604 N XB-FEAT-29089978 Created page with "=''pkn2l.4''= This is the community wiki page for the Xenopus pkn2l.4 genes. Please feel free to add any information here, that is relevant to these genes and is not already c..." current
- 15:1315:13, 13 July 2023 diff hist −17 XB-FEAT-29079470 →nomenclature changes current
- 15:1015:10, 13 July 2023 diff hist +618 N XB-FEAT-29092170 Created page with "= '' pkn1l.2'' = This is the community wiki page for the '' Xenopus '' ''pkn1l.2'' genes. Please feel free to add any information here, that is relevant to these genes and..." current
- 15:0615:06, 13 July 2023 diff hist +2 XB-FEAT-29091846 →orthology current
- 15:0615:06, 13 July 2023 diff hist +611 N XB-FEAT-29091846 Created page with "= '' pkn1l'' = This is the community wiki page for the '' Xenopus '' ''pkn1l '' genes. Please feel free to add any information here, that is relevant to these genes and is..."
- 14:5714:57, 13 July 2023 diff hist +40 XB-FEAT-29079470 →nomenclature changes
- 14:5414:54, 13 July 2023 diff hist +584 N XB-FEAT-29079470 Created page with "=''pkn2l.3''= This is the community wiki page for the ''Xenopus'' ''pkn2l.3'' genes. Please feel free to add any information here, that is relevant to these genes and is not a..."
- 14:5214:52, 13 July 2023 diff hist +4 XB-FEAT-29091842 →orthology current
- 14:5114:51, 13 July 2023 diff hist 0 XB-FEAT-29091842 →orthology
- 14:5114:51, 13 July 2023 diff hist 0 XB-FEAT-29091842 →nomenclature changes
- 14:5114:51, 13 July 2023 diff hist −1 XB-FEAT-29091842 →pnk2l.2
- 14:5014:50, 13 July 2023 diff hist −1 XB-FEAT-29091842 →=orthology
- 14:5014:50, 13 July 2023 diff hist 0 XB-FEAT-29091842 →nomenclature chnages
- 14:4914:49, 13 July 2023 diff hist +616 N XB-FEAT-29091842 Created page with "= ''pnk2l.2'' = This is the community wiki page for the '' Xenopus' '' ''pnk2l.2'' genes. Please feel free to add any information here, that is relevant to these genes and..."
- 14:3914:39, 13 July 2023 diff hist +14 XB-FEAT-29085518 →nomenclature changes
- 14:3914:39, 13 July 2023 diff hist 0 XB-FEAT-29085518 →pkn2l
- 14:3814:38, 13 July 2023 diff hist +4 XB-FEAT-29085518 →pkn2l
- 14:3814:38, 13 July 2023 diff hist +630 N XB-FEAT-29085518 Created page with "= pkn2l = This is the community wiki page for the '' Xenopus '' ''pkn2l '' genes. Please feel free to add any information here, that is relevant to these genes and is not al..."
- 14:2814:28, 13 July 2023 diff hist +401 N XB-FEAT-29089986 Created page with "= '' ctss.3'' = This is the community wiki page for the '' Xenopus '' ''ctss.3'' genes. Please feel free to add any information here, that is relevant to these genes and is..." current
- 14:2014:20, 13 July 2023 diff hist +200 XB-FEAT-29098998 →protein sequence current
- 14:1414:14, 13 July 2023 diff hist +619 N XB-FEAT-29098998 Created page with " =protein sequence= XB used this protein accession to characterize this gene: >NP_001076821.2 uncharacterized protein LOC594890 precursor [Xenopus tropicalis] MGFYRQCLIGLFALL..."
- 14:0814:08, 13 July 2023 diff hist +4 XB-FEAT-986811 →ctsk.3 current
- 14:0714:07, 13 July 2023 diff hist +200 XB-FEAT-986811 →loc100490139
- 13:5513:55, 13 July 2023 diff hist +368 N XB-FEAT-29098938 Created page with " =gene nomenclature updates= 13 JULY 2023 ''Xenopus'' gene symbol changed from ''LOC448216'' to ''ctsk.2'' ''Xenopus'' gene from ''cathepsin K (pycnodysostosis)'' to ''cath..." current
- 13:4213:42, 13 July 2023 diff hist +467 N XB-FEAT-29098762 Created page with "=''rps6ka4l''= This is the community wiki page for the '' Xenopus '' ''rps6ka4l '' genes. Please feel free to add any information here, that is relevant to these genes but t..." current
- 13:2213:22, 13 July 2023 diff hist +548 N XB-FEAT-29098926 Created page with "=''ccnb5''= =nomenclature updates= 05JULY 2023 ''Xenopus'' gene symbol changed from ''LOC394448'' to ''ccnb5''. This change is supported by DIOPT/EggNog analaysis, which m..." current
- 06:5706:57, 13 July 2023 diff hist +295 XB-FEAT-5802730 →nomenclature updates current
- 06:5406:54, 13 July 2023 diff hist −46 XB-FEAT-5802730 →nomenclature changes
- 06:5406:54, 13 July 2023 diff hist +21 XB-FEAT-5802730 →XB5802730 provisional rab10l
11 July 2023
- 15:4815:48, 11 July 2023 diff hist +380 Protocols →Xenopus oocyte cell free extract
- 15:4315:43, 11 July 2023 diff hist +27 Protocols →Protocols published in non-CSHL Journals- click to view-
7 July 2023
- 06:3706:37, 7 July 2023 diff hist +147 XB-FEAT-946621 →nomenclature changes current
- 06:3606:36, 7 July 2023 diff hist −169 XB-FEAT-946621 →nomenclature changes
- 06:3606:36, 7 July 2023 diff hist +5 XB-FEAT-946621 →hif1a
5 July 2023
- 12:3912:39, 5 July 2023 diff hist 0 XB-FEAT-29071333 →atrx2 current
- 08:1808:18, 5 July 2023 diff hist +2 XB-FEAT-22065331 →nomenclature changes current
- 08:1708:17, 5 July 2023 diff hist +80 XB-FEAT-22065331 →nomenclature changes
- 07:4307:43, 5 July 2023 diff hist +209 XB-FEAT-493800 →larp6 current
1 July 2023
- 14:5814:58, 1 July 2023 diff hist −6 XB-FEAT-13579844 →c1h4orf48 current
30 June 2023
- 14:4014:40, 30 June 2023 diff hist +426 XB-FEAT-13579844 →nomenclature changes
- 14:2314:23, 30 June 2023 diff hist +180 XB-FEAT-5767696 →fam120a current
- 14:2114:21, 30 June 2023 diff hist +157 XB-FEAT-6037326 →fam120c current
- 14:1114:11, 30 June 2023 diff hist +180 XB-FEAT-980081 →fam120b current
- 14:0914:09, 30 June 2023 diff hist +176 XB-FEAT-494052 →tubgcp5 current
- 14:0314:03, 30 June 2023 diff hist +175 XB-FEAT-491695 →tubgcp4 current
- 13:5713:57, 30 June 2023 diff hist +174 XB-FEAT-490982 →tubgcp3 current
- 13:5113:51, 30 June 2023 diff hist +175 XB-FEAT-490605 →tubgcp6 current
- 13:4913:49, 30 June 2023 diff hist +168 XB-FEAT-490452 →tubgcp2 current
- 12:2912:29, 30 June 2023 diff hist +307 XB-FEAT-995201 →loc100158538 current
22 June 2023
- 12:1712:17, 22 June 2023 diff hist +4 XB-FEAT-992706 →nomenclature changes current
- 12:1612:16, 22 June 2023 diff hist +1,059 XB-FEAT-992706 →nomenclature changes
- 12:1012:10, 22 June 2023 diff hist +461 XB-FEAT-992706 →ca13
- 12:0212:02, 22 June 2023 diff hist +5 XB-FEAT-992706 →ca13
21 June 2023
- 12:1012:10, 21 June 2023 diff hist +182 XB-FEAT-981838 →exog current
- 11:2711:27, 21 June 2023 diff hist +5 XB-FEAT-5846793 →znf33b current
- 11:2011:20, 21 June 2023 diff hist +676 XB-FEAT-29087790 →RefSeq protein accession current
- 11:1011:10, 21 June 2023 diff hist +589 N XB-FEAT-29087790 Created page with "=RefSeq protein accession= >XP_031760301.1 gastrula zinc finger protein XlCGF26.1-like [Xenopus tropicalis] MRFCSTQNLLIHQRIHTGRSFVCSKCGKYFSHRKILIAHKWVHTGRKPFTCTESNKGFLWNRDLQQH..."
- 11:0811:08, 21 June 2023 diff hist +849 XB-FEAT-29077586 →refSeq protein accession current
- 11:0011:00, 21 June 2023 diff hist +747 N XB-FEAT-29077586 Created page with "=refSeq protein accession= XP_031760308.1 gastrula zinc finger protein XlCGF57.1-like isoform X1 [Xenopus tropicalis] MEINPVMTTVLQTNNNTMSGPTPVTSEVPIESPKTNQLSKGQRPGKPFVCAKCKRRF..."
- 10:5510:55, 21 June 2023 diff hist −1 XB-FEAT-29097482 →nomenclature changes current
- 10:5510:55, 21 June 2023 diff hist +687 N XB-FEAT-29097482 Created page with "=''znf33bl''= This is the community wiki page for ''Xenopus'' ''znf33bl'' genes. Please record here any relenat information that is not captured elsewhere on Xenbase. =nomenc..."
- 10:3810:38, 21 June 2023 diff hist +588 N XB-FEAT-29099066 Created page with "=''znf24l ''= This is the Xenbase wiki page for ''Xenopus '' ''znf24l'' genes. Please record here any relevant information about ''znf24l'' not captured elsewhere on Xenbase...." current
- 10:2710:27, 21 June 2023 diff hist +15 XB-FEAT-29091390 →nomenclature changes current
- 10:2610:26, 21 June 2023 diff hist +439 N XB-FEAT-29091390 Created page with "== =nomenclature changes= 20JUNE2023 ''Xenopus'' gene name changed from ''gastrula zinc finger protein XlCGF8.2DB-like'' to ''zinc finger and SCAN domain containing 32 like''..."
- 07:4007:40, 21 June 2023 diff hist +153 XB-FEAT-6046830 →padi4 current
- 07:3107:31, 21 June 2023 diff hist +155 XB-FEAT-996813 →padi2 current
20 June 2023
- 12:2112:21, 20 June 2023 diff hist +4 XB-FEAT-5789487 →ptgr1 current
- 12:2112:21, 20 June 2023 diff hist +10 XB-FEAT-5789487 →nomenclature updates
- 12:2012:20, 20 June 2023 diff hist −2 XB-FEAT-5789487 →ptgr1.1
17 June 2023
- 19:1319:13, 17 June 2023 diff hist +400 XB-FEAT-482447 →tdgf1
- 19:0919:09, 17 June 2023 diff hist +307 XB-FEAT-5995511 →nomenclature changes current
- 19:0419:04, 17 June 2023 diff hist +151 XB-FEAT-1217654 →bnc1 current
- 19:0119:01, 17 June 2023 diff hist +145 XB-FEAT-953156 →bnc2 current
- 18:5918:59, 17 June 2023 diff hist +135 XB-FEAT-920751 →shox current
- 18:5718:57, 17 June 2023 diff hist +138 XB-FEAT-480992 →shox2 current
16 June 2023
- 16:4416:44, 16 June 2023 diff hist +15 XB-FEAT-22063241 →nomenclature changes current
- 16:4416:44, 16 June 2023 diff hist +440 N XB-FEAT-22063241 Created page with "=nomenclature changes= 18JUNE2023 Gene name and symbol was updated from ''XB22063241 provisional ortholog of lymphocyte antigen 6 complex, locus A2'' to ''ly6g6e , lymphocyte..."
- 10:3310:33, 16 June 2023 diff hist +4 XB-FEAT-491910 →il17bl current
- 10:3310:33, 16 June 2023 diff hist +137 XB-FEAT-491910 →il17bl
- 08:1108:11, 16 June 2023 diff hist +1 XB-FEAT-29093310 →nomenclature changes current
- 08:1108:11, 16 June 2023 diff hist +385 N XB-FEAT-29093310 Created page with "=''or5as1''= This is the community wiki page for the ''Xenopus'' ''or5as1'' genes. Please feel free to record here anything relevant to this gene that is not recorded elsewher..."
15 June 2023
- 11:3911:39, 15 June 2023 diff hist +11 XB-FEAT-950176 →gene annotation corrections current
- 11:3511:35, 15 June 2023 diff hist +10 XB-FEAT-960657 →gene annotation corrections current
- 11:1611:16, 15 June 2023 diff hist +25 XB-FEAT-29077890 →cupin1.2 current
- 11:1411:14, 15 June 2023 diff hist +1,432 N XB-FEAT-29077890 Created page with "=cupin1.2= There's a complex evolutionary history of a set of genes including those previously called '''DYNAP''' in the region between C18orf54 and RAB27b. After review fro..."
- 10:5310:53, 15 June 2023 diff hist +20 XB-FEAT-5953480 →nomenclature changes and synteny current
- 10:4810:48, 15 June 2023 diff hist +1 XB-FEAT-29071321 →synteny patterns for INPPL1A/B in Vertebrates current
- 10:4810:48, 15 June 2023 diff hist +224 XB-FEAT-29071321 →synteny and orthology
- 10:4610:46, 15 June 2023 diff hist +3 XB-FEAT-29071321 →inppl1b
- 10:4510:45, 15 June 2023 diff hist +2,275 XB-FEAT-29071321 →inpp1b
- 09:5809:58, 15 June 2023 diff hist +106 XB-FEAT-988106 →adam33
13 June 2023
- 12:2312:23, 13 June 2023 diff hist +22 XB-FEAT-989872 →accs
- 12:2212:22, 13 June 2023 diff hist +682 XB-FEAT-989872 →nomenclature notes
9 June 2023
- 10:3010:30, 9 June 2023 diff hist −539 XB-FEAT-955111 →nomenclature changes current
- 10:3010:30, 9 June 2023 diff hist −14 XB-FEAT-955111 →LOC100496122
- 10:2710:27, 9 June 2023 diff hist 0 XB-FEAT-955111 →syt13
- 10:2610:26, 9 June 2023 diff hist 0 XB-FEAT-955111 →nomenclature changes
- 10:2310:23, 9 June 2023 diff hist −708 XB-FEAT-955111 →nomenclature changes
- 10:2010:20, 9 June 2023 diff hist +708 XB-FEAT-955111 →LOC100494466
- 10:1110:11, 9 June 2023 diff hist +584 XB-FEAT-955111 →syt13
8 June 2023
- 15:2015:20, 8 June 2023 diff hist +315 XB-FEAT-5924997 →NOMENCLATURE CHANGES
- 14:4514:45, 8 June 2023 diff hist +360 N XB-FEAT-22068128 Created page with "=''spmip4''= his is the community wiki page for the gene ''spmip4'' please feel free to add any information that is relevant to this gene that is not already captured elsewher..." current
- 14:4114:41, 8 June 2023 diff hist −191 XB-FEAT-5826965 →nomenclature changes
- 14:3914:39, 8 June 2023 diff hist −4 XB-FEAT-5826965 →LOC100290036
- 14:3114:31, 8 June 2023 diff hist +144 XB-FEAT-947876 →nomenclature changes current
- 14:2914:29, 8 June 2023 diff hist +371 XB-FEAT-1016706 →setd3 current
- 14:2614:26, 8 June 2023 diff hist +193 XB-FEAT-995589 →spo11 current
- 14:2514:25, 8 June 2023 diff hist +4 XB-FEAT-952801 →mettl16 current
- 14:2414:24, 8 June 2023 diff hist +149 XB-FEAT-952801 →nomenclature changes
- 14:2314:23, 8 June 2023 diff hist +155 XB-FEAT-5811218 →nomenclature updates current
- 14:2114:21, 8 June 2023 diff hist +145 XB-FEAT-5809154 →nomenclature changes current
- 14:2014:20, 8 June 2023 diff hist +161 XB-FEAT-5749472 →nomenclature updates current
- 14:1814:18, 8 June 2023 diff hist +4 XB-FEAT-1219056 →zfyve28a current
- 14:1714:17, 8 June 2023 diff hist +4 XB-FEAT-965487 →mettl13 current
- 14:1614:16, 8 June 2023 diff hist +213 XB-FEAT-965487 →nomenclature changes
- 13:4913:49, 8 June 2023 diff hist +8 XB-FEAT-29071333 →Xenopus artx genes
- 13:4813:48, 8 June 2023 diff hist −20 XB-FEAT-29071333 →synteny patterns
- 13:4713:47, 8 June 2023 diff hist +114 XB-FEAT-29071333 →Xenopus artx genes
- 13:4613:46, 8 June 2023 diff hist −1 XB-FEAT-29071333 →atrx2
- 13:4613:46, 8 June 2023 diff hist +1,149 XB-FEAT-29071333 →Xenopus artx genes
- 13:3113:31, 8 June 2023 diff hist −2 XB-FEAT-29071333 →Xenopus artx genes
- 13:1613:16, 8 June 2023 diff hist +596 XB-FEAT-29071333 →atrx2
- 13:0513:05, 8 June 2023 diff hist +11 N XB-FEAT-29071333 Created page with "=''atrx2''="
- 10:5910:59, 8 June 2023 diff hist +3 XB-FEAT-22065335 →Synteny in Xenopus current
- 10:5910:59, 8 June 2023 diff hist −10 XB-FEAT-22065335 →Synteny in Xenopus
- 10:5810:58, 8 June 2023 diff hist +494 XB-FEAT-22065335 →Synteny in Xenopus
- 10:5610:56, 8 June 2023 diff hist +245 XB-FEAT-22065335 →nomenclature and orthology notes
- 10:5210:52, 8 June 2023 diff hist +19 XB-FEAT-22065335 →nomenclature and orthology notes
- 10:5210:52, 8 June 2023 diff hist +114 XB-FEAT-22065335 →Synteny in Xenopus
- 10:5010:50, 8 June 2023 diff hist −2 XB-FEAT-22065335 →Synteny in Xenopus
- 10:4910:49, 8 June 2023 diff hist +329 XB-FEAT-22065335 →Synteny in Xenopus
- 10:4510:45, 8 June 2023 diff hist +110 XB-FEAT-22065335 →Synteny in Xenopus
- 10:3910:39, 8 June 2023 diff hist +137 XB-FEAT-22065335 No edit summary
- 10:3410:34, 8 June 2023 diff hist +715 XB-FEAT-22065335 →nomenclature and orthology notes
- 10:2910:29, 8 June 2023 diff hist 0 XB-FEAT-22065335 →mypopl1
- 10:1010:10, 8 June 2023 diff hist −4 XB-FEAT-22065335 →msantdl.2
- 10:0710:07, 8 June 2023 diff hist +247 N XB-FEAT-22065335 Created page with "=''msantdl.2 ''= This is the community wiki page for the gene ''msantdl.2 '' please feel free to add any information that is relevant to this gene that is not already capture..."
- 08:3608:36, 8 June 2023 diff hist +29 m XB-FEAT-5968415 →nomenclature changes current
- 08:3508:35, 8 June 2023 diff hist +153 XB-FEAT-5968415 →nomenclature changes
7 June 2023
- 14:1914:19, 7 June 2023 diff hist +16 XB-FEAT-22169522 →mypopl1 current
- 14:1914:19, 7 June 2023 diff hist +1 XB-FEAT-22169522 →mypop2
- 14:1814:18, 7 June 2023 diff hist +1 XB-FEAT-22169522 →protein sequence for X. tropicalis mypop2
- 14:1814:18, 7 June 2023 diff hist +508 XB-FEAT-22169522 →nomenclature changes
- 12:1312:13, 7 June 2023 diff hist +2 XB-FEAT-22065331 →nomenclature changes
- 12:1312:13, 7 June 2023 diff hist +93 XB-FEAT-22065331 →nomenclature changes
- 12:1012:10, 7 June 2023 diff hist −4 XB-FEAT-22065331 →msantdl.1
- 12:1012:10, 7 June 2023 diff hist +112 XB-FEAT-22065331 →nomenclature changes
- 12:0912:09, 7 June 2023 diff hist −28 XB-FEAT-22065331 →msantdl.1 [provisional]
- 12:0812:08, 7 June 2023 diff hist +28 XB-FEAT-5893459 →nomenclature changes current
- 11:5611:56, 7 June 2023 diff hist +200 N XB-FEAT-22068619 Created page with "=''XB22068619 ''= This is the community wiki page for the gene ''XB22068619 '' please feel free to add any information that is relevant to this gene that is not already captu..." current
- 11:5511:55, 7 June 2023 diff hist +79 XB-FEAT-22066209 →nomenclature changes current
- 11:4611:46, 7 June 2023 diff hist +94 XB-FEAT-22066195 →nomenclature changes current
- 11:3811:38, 7 June 2023 diff hist +4 XB-FEAT-25874688 →orthogy and synteny current
- 11:3711:37, 7 June 2023 diff hist +1 XB-FEAT-25874688 →orthogy and synteny
- 11:3211:32, 7 June 2023 diff hist 0 XB-FEAT-25874688 →orthogy nad synteny
- 11:3111:31, 7 June 2023 diff hist +680 N XB-FEAT-25874688 Created page with "=''trat1l''= This is the community wiki page for the gene ''trat1l'' please feel free to add any information that is relevant to this gene that is not already captured elsewh..."
- 11:1811:18, 7 June 2023 diff hist +49 XB-FEAT-5802613 →nomenclature changes current
- 11:1611:16, 7 June 2023 diff hist +4 XB-FEAT-5802613 →tmt1a
- 11:1511:15, 7 June 2023 diff hist +193 XB-FEAT-22069556 →nomenclature updates current
- 11:1411:14, 7 June 2023 diff hist +217 N XB-FEAT-22069556 Created page with "=nomenclature updates= 05 JUNE 2023 ''Xenopus'' gene symbol and gene name has changed for genepage ID: 22069550 From ''mettl7a.3, methyltransferase like 7A, gene 3'' to ''tm..."
- 10:4910:49, 7 June 2023 diff hist +792 XB-FEAT-5740333 →synteny maps current
- 10:3810:38, 7 June 2023 diff hist +80 XB-FEAT-5740333 →nomenclature changes
- 10:3710:37, 7 June 2023 diff hist +413 XB-FEAT-5740333 →synteny maps
- 09:2009:20, 7 June 2023 diff hist +292 XB-FEAT-1221158 →nomenclature changes current
- 09:1909:19, 7 June 2023 diff hist +3 XB-FEAT-1221158 →ift70
- 09:1609:16, 7 June 2023 diff hist +239 XB-FEAT-995438 →stag3l2 current
- 08:3308:33, 7 June 2023 diff hist +92 XB-FEAT-6467139 →ces3.1
- 08:3008:30, 7 June 2023 diff hist +492 N XB-FEAT-6464249 Created page with "=''tektl1''= This is the community wiki page for the gene ''tektl1'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe..." current
- 08:2708:27, 7 June 2023 diff hist +330 XB-FEAT-5865160 →tex43 current
- 08:2308:23, 7 June 2023 diff hist +313 XB-FEAT-5846659 →nomenclature changes current
6 June 2023
- 14:4614:46, 6 June 2023 diff hist +6 XB-FEAT-5800172 →nomenclature changes current
- 14:4514:45, 6 June 2023 diff hist +105 XB-FEAT-5800172 →nomenclature changes
- 14:4414:44, 6 June 2023 diff hist −6 XB-FEAT-5800172 →c1h4orf45
- 14:4414:44, 6 June 2023 diff hist +314 XB-FEAT-5800172 →nomenclature changes
- 14:3914:39, 6 June 2023 diff hist +215 XB-FEAT-940868 →c11orf1 current
- 13:0013:00, 6 June 2023 diff hist +5 XB-FEAT-6461105 →spata48 current
- 12:5912:59, 6 June 2023 diff hist +302 XB-FEAT-6461105 →nomenclature changes
- 12:5312:53, 6 June 2023 diff hist +138 N XB-FEAT-6469233 Created page with "=nomenclature updates= 05JUNE 2023 Human name has changed for Entrez Gene: 10086. From HERV-H LTR-associating 1 to HHLA1 neighbor of OC90" current
- 12:5112:51, 6 June 2023 diff hist +331 XB-FEAT-5864984 →tepp current
- 12:4812:48, 6 June 2023 diff hist +344 XB-FEAT-6456700 →fam166b current
- 12:4512:45, 6 June 2023 diff hist +342 XB-FEAT-974848 →fam166a current
- 11:5611:56, 6 June 2023 diff hist +1,477 N XB-FEAT-22065730 Created page with "=''ocm4.10''= This is the community wiki page for the gene ''ocm4.10'' please feel free to add any information that is relevant to this gene that is not already captured elsew..." current
- 11:5411:54, 6 June 2023 diff hist +1,474 N XB-FEAT-22065778 Created page with "=''ocm4.9''= This is the community wiki page for the gene ''ocm4.9'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe..." current
- 11:5211:52, 6 June 2023 diff hist +1,474 N XB-FEAT-22065774 Created page with "=''ocm4.8''= This is the community wiki page for the gene ''ocm4.8'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe..." current
- 11:5111:51, 6 June 2023 diff hist +1,474 N XB-FEAT-22065770 Created page with "=''ocm4.7''= This is the community wiki page for the gene ''ocm4.7'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe..." current
- 11:4811:48, 6 June 2023 diff hist +23 XB-FEAT-5768035 →ocm4.3 current
- 11:4811:48, 6 June 2023 diff hist +503 XB-FEAT-5768035 →ocm.2
- 11:4511:45, 6 June 2023 diff hist 0 XB-FEAT-22065766 →synteny maps current
- 11:4511:45, 6 June 2023 diff hist +1,468 N XB-FEAT-22065766 Created page with "=o''cm4.6''= This is the community wiki page for the gene ''ocm4.6'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe..."
- 11:3811:38, 6 June 2023 diff hist +839 XB-FEAT-5936749 →ocm4.4 current
- 11:3511:35, 6 June 2023 diff hist +838 XB-FEAT-5837859 →ocm4.2 current
- 11:3411:34, 6 June 2023 diff hist +835 XB-FEAT-22065762 →nomenclature updates current
- 11:3311:33, 6 June 2023 diff hist +14 XB-FEAT-5833500 →synteny notes current
- 11:3011:30, 6 June 2023 diff hist +3 XB-FEAT-5833500 →synteny notes
- 11:3011:30, 6 June 2023 diff hist +10 XB-FEAT-5833500 →suynteny notes
- 11:2911:29, 6 June 2023 diff hist +1,432 XB-FEAT-5833500 →ocm3
- 11:2611:26, 6 June 2023 diff hist +4 XB-FEAT-488139 →ocm1
- 11:2511:25, 6 June 2023 diff hist +1 XB-FEAT-488139 →ocm2
- 11:1311:13, 6 June 2023 diff hist −4 XB-FEAT-22065762 →ocm4.1
- 11:1211:12, 6 June 2023 diff hist +179 XB-FEAT-22065762 →ocm4.1
- 11:1011:10, 6 June 2023 diff hist −2 XB-FEAT-993074 →selenow1 current
- 11:0911:09, 6 June 2023 diff hist +214 XB-FEAT-993074 →nomenclature changes
- 11:0611:06, 6 June 2023 diff hist +4 XB-FEAT-993074 →selenow1
- 11:0311:03, 6 June 2023 diff hist +296 XB-FEAT-6054425 →spata5 current
- 10:5810:58, 6 June 2023 diff hist +6 XB-FEAT-1013836 →nomenclature changes current
- 10:5410:54, 6 June 2023 diff hist +344 XB-FEAT-6044598 →rnf165 current
- 10:4910:49, 6 June 2023 diff hist +306 XB-FEAT-6042222 →c1orf88 current
- 10:4510:45, 6 June 2023 diff hist +347 XB-FEAT-6037716 →odf3l1 current
- 10:4210:42, 6 June 2023 diff hist +152 XB-FEAT-6034942 →c17orf95 current
- 10:2210:22, 6 June 2023 diff hist +302 XB-FEAT-994081 →nomenclature changes current
- 10:1810:18, 6 June 2023 diff hist +121 XB-FEAT-977190 →ythdf2 current
- 10:1710:17, 6 June 2023 diff hist −24 XB-FEAT-956072 →nomenclature changes current
- 10:1610:16, 6 June 2023 diff hist +342 XB-FEAT-956072 →nomenclature changes
- 10:1510:15, 6 June 2023 diff hist −361 XB-FEAT-956072 →nomenclature updates
- 10:1510:15, 6 June 2023 diff hist +369 XB-FEAT-956072 →nomenclature changes
- 10:0910:09, 6 June 2023 diff hist −5 XB-FEAT-5731259 →c1h4orf47 current
- 10:0910:09, 6 June 2023 diff hist +309 XB-FEAT-5731259 →nomenclature changes
- 09:1409:14, 6 June 2023 diff hist +141 XB-FEAT-1006154 →stag3l4 current
- 09:1109:11, 6 June 2023 diff hist +4 XB-FEAT-979408 →fgl1a current
- 09:0809:08, 6 June 2023 diff hist +339 XB-FEAT-5889413 →odf3 current
- 09:0509:05, 6 June 2023 diff hist −10 XB-FEAT-988445 →c1h18orf25 current
- 09:0509:05, 6 June 2023 diff hist +316 XB-FEAT-988445 →nomenclature changes
- 09:0209:02, 6 June 2023 diff hist +320 XB-FEAT-961527 →c11orf66 current
- 09:0009:00, 6 June 2023 diff hist +165 XB-FEAT-1004177 →ythdc1 current
- 08:5808:58, 6 June 2023 diff hist +192 XB-FEAT-998505 →lztr1 current
- 08:5608:56, 6 June 2023 diff hist +4 XB-FEAT-994912 →clpb current
- 08:5608:56, 6 June 2023 diff hist +177 XB-FEAT-994912 →nomenclature changes
- 08:5108:51, 6 June 2023 diff hist +189 XB-FEAT-972022 →mat2b current
- 08:4808:48, 6 June 2023 diff hist +313 XB-FEAT-967078 →spata5l1 current
- 08:4308:43, 6 June 2023 diff hist +145 XB-FEAT-998551 →stag1 current
- 08:4108:41, 6 June 2023 diff hist +200 XB-FEAT-947601 →gfod1 current
- 08:4008:40, 6 June 2023 diff hist +412 XB-FEAT-5952632 →c1orf112 current
- 08:3708:37, 6 June 2023 diff hist +187 XB-FEAT-5943529 →ythdf1 current
- 08:3308:33, 6 June 2023 diff hist +166 XB-FEAT-5881730 →ythdc2 current
- 08:3208:32, 6 June 2023 diff hist +399 XB-FEAT-5864225 →lexm current
- 08:2608:26, 6 June 2023 diff hist +1 XB-FEAT-5822279 →mett5d1 current
- 08:2508:25, 6 June 2023 diff hist +179 XB-FEAT-5822279 →mett5d1
- 08:2108:21, 6 June 2023 diff hist +161 XB-FEAT-5811218 →c1orf156
- 08:1908:19, 6 June 2023 diff hist +161 XB-FEAT-5752936 →nomenclature changes current
- 08:1908:19, 6 June 2023 diff hist +5 XB-FEAT-5752936 →ythdf3
5 June 2023
- 14:2714:27, 5 June 2023 diff hist +165 XB-FEAT-5749472 →mettl9
- 14:2614:26, 5 June 2023 diff hist +234 XB-FEAT-5740206 →gfod2 current
- 14:2214:22, 5 June 2023 diff hist +35 XB-FEAT-5995511 →nomenclature changes
- 14:1914:19, 5 June 2023 diff hist +171 XB-FEAT-5995511 →nomenclature changes
- 14:0714:07, 5 June 2023 diff hist +23 XB-FEAT-5995511 →nomenclature changes
- 14:0614:06, 5 June 2023 diff hist +948 XB-FEAT-29072461 →scrt2 current
- 13:5313:53, 5 June 2023 diff hist +461 XB-FEAT-940214 →dusp13 current
- 13:1413:14, 5 June 2023 diff hist −30 XB-FEAT-5846708 →protein accession uused current
- 13:1313:13, 5 June 2023 diff hist −5 XB-FEAT-5846708 →loc100498328
- 13:1313:13, 5 June 2023 diff hist +165 XB-FEAT-5846708 →loc100498328
- 13:1013:10, 5 June 2023 diff hist +2,108 XB-FEAT-5846708 →loc100498328
- 12:4312:43, 5 June 2023 diff hist +1 XB-FEAT-964421 →pgcl current
- 12:4212:42, 5 June 2023 diff hist −7 XB-FEAT-964421 →nomenclature changes
- 12:2012:20, 5 June 2023 diff hist +106 XB-FEAT-22164556 →nomenclature changes current
- 11:4611:46, 5 June 2023 diff hist +1 XB-FEAT-22063314 →orthology current
- 11:4511:45, 5 June 2023 diff hist −1 XB-FEAT-22063314 →orthology
- 11:4411:44, 5 June 2023 diff hist +2 XB-FEAT-22068614 →nomenclature changes current
- 10:3010:30, 5 June 2023 diff hist +2 XB-FEAT-5764782 →loc733303 current
- 10:2910:29, 5 June 2023 diff hist +219 XB-FEAT-5764782 →loc733303
- 10:1710:17, 5 June 2023 diff hist 0 XB-FEAT-18006544 →nomenlcature changes current
- 10:0510:05, 5 June 2023 diff hist +232 XB-FEAT-980730 →unnamed current
- 10:0110:01, 5 June 2023 diff hist 0 XB-FEAT-990052 →glul-like.1 current
- 10:0010:00, 5 June 2023 diff hist +19 XB-FEAT-990052 →Syntenty in Xenopus
- 09:5809:58, 5 June 2023 diff hist +173 XB-FEAT-990052 →nomenclature changes
- 08:3308:33, 5 June 2023 diff hist +26 XB-FEAT-994490 →phka2 current
2 June 2023
- 13:0213:02, 2 June 2023 diff hist +205 XB-FEAT-5904271 →fcrl2 current
- 11:0411:04, 2 June 2023 diff hist +455 XB-FEAT-22063318 →xicof6.1l current
1 June 2023
- 14:0514:05, 1 June 2023 diff hist +576 XB-FEAT-5961731 →loc100494294 current
- 12:5012:50, 1 June 2023 diff hist +571 XB-FEAT-5887026 →unnamed current
- 12:3312:33, 1 June 2023 diff hist +389 N XB-FEAT-22041759 Created page with "=''znf84l''= This is the Xenbase community wiki page for ''Xenopus'' ''znf84l'' genes. Please feel free to add any information here relevant to ''znf84l'' that is not captured..." current
- 12:0412:04, 1 June 2023 diff hist +1 XB-FEAT-5779569 →adap1l current
- 12:0312:03, 1 June 2023 diff hist +4 XB-FEAT-5779569 →adap1l
- 08:0208:02, 1 June 2023 diff hist +341 XB-FEAT-17329844 →synteny current
- 08:0008:00, 1 June 2023 diff hist +530 XB-FEAT-17329844 →orthology
- 07:5907:59, 1 June 2023 diff hist +14 XB-FEAT-17329844 →protein for GeneID:100497492
- 07:5807:58, 1 June 2023 diff hist +284 XB-FEAT-17329844 →orthology
- 07:5707:57, 1 June 2023 diff hist +130 XB-FEAT-17329844 →nomenclature changes
- 07:5607:56, 1 June 2023 diff hist +2 XB-FEAT-17329844 →prss57
- 07:5507:55, 1 June 2023 diff hist +494 XB-FEAT-17329844 →protein for GeneID:100497492
31 May 2023
- 14:2014:20, 31 May 2023 diff hist +237 XB-FEAT-5897023 →unnamed current
- 14:1314:13, 31 May 2023 diff hist +201 XB-FEAT-964421 →unnamed
- 14:0614:06, 31 May 2023 diff hist +207 XB-FEAT-5961406 →mr1-like current
- 14:0314:03, 31 May 2023 diff hist +374 N XB-FEAT-18006544 Created page with "=''lrrn1l''= This is teh community wiki page for the ''Xenopus '' ''lrrn1l'' genes. Please feel free to record here any relevant information about ''lrrn1l'' that is not recor..."
- 13:5413:54, 31 May 2023 diff hist +717 XB-FEAT-5806147 →larp6l current
- 13:4213:42, 31 May 2023 diff hist −1 XB-FEAT-5806147 →unnamed
- 12:5812:58, 31 May 2023 diff hist +240 XB-FEAT-955336 →lrrc38 current
- 12:5612:56, 31 May 2023 diff hist −8 XB-FEAT-5860196 →grik5-like.1 current
- 12:5612:56, 31 May 2023 diff hist +300 XB-FEAT-5860196 →grik5-like.1
- 12:4812:48, 31 May 2023 diff hist +8 XB-FEAT-22172581 →dtx3l
- 12:4812:48, 31 May 2023 diff hist +7 XB-FEAT-22172581 →nomenclature changes
- 12:4112:41, 31 May 2023 diff hist −3 XB-FEAT-22172581 →dtx3-like
- 11:0811:08, 31 May 2023 diff hist −3 XB-FEAT-951047 →nomenclature changes current
- 10:5110:51, 31 May 2023 diff hist +78 XB-FEAT-5883963 →nomenclature change current
- 10:5010:50, 31 May 2023 diff hist +150 XB-FEAT-5883963 →atp13a5
- 10:4310:43, 31 May 2023 diff hist +398 N XB-FEAT-18006559 Created page with "=''atp12al''= This is the community wiki page for ''atp12al''. Please fee free to add here any relevant information about this gene that is not represented elsewhere on Xenbas..." current
- 07:0207:02, 31 May 2023 diff hist +1 XB-FEAT-5835883 →nomenclature changes current
- 06:4806:48, 31 May 2023 diff hist +187 XB-FEAT-5827395 →loc100133583 current
- 06:4406:44, 31 May 2023 diff hist +132 XB-FEAT-5820455 →loc100490553 current
30 May 2023
- 13:0113:01, 30 May 2023 diff hist +334 XB-FEAT-25874530 →nomenclature changes current
- 12:5912:59, 30 May 2023 diff hist +1 XB-FEAT-6449958 No edit summary current
- 12:5912:59, 30 May 2023 diff hist +333 XB-FEAT-6449958 No edit summary
- 12:5112:51, 30 May 2023 diff hist +16 XB-FEAT-25874530 →haus3
- 12:5112:51, 30 May 2023 diff hist +391 XB-FEAT-6449958 →haus3l
- 12:4812:48, 30 May 2023 diff hist +548 N XB-FEAT-25874530 →haus3
26 May 2023
- 15:1315:13, 26 May 2023 diff hist +527 XB-FEAT-994081 →c17orf98
- 15:1015:10, 26 May 2023 diff hist −1 XB-FEAT-996620 →nomenclature changes current
- 15:1015:10, 26 May 2023 diff hist −15 XB-FEAT-996620 →nomenclature changes
- 15:1015:10, 26 May 2023 diff hist +517 XB-FEAT-996620 →loc100485462
- 15:0715:07, 26 May 2023 diff hist +526 XB-FEAT-6032449 →c20orf85 current
- 15:0415:04, 26 May 2023 diff hist +442 XB-FEAT-1006443 →nomenclature updates current
- 15:0315:03, 26 May 2023 diff hist +1 XB-FEAT-1006443 →cep15
- 15:0215:02, 26 May 2023 diff hist +475 XB-FEAT-6032782 →c13orf42 current
- 15:0115:01, 26 May 2023 diff hist +477 XB-FEAT-5798590 →c2orf76 current
- 14:5114:51, 26 May 2023 diff hist +653 N XB-FEAT-6462368 Created page with "= ''c8h8orf48''= This is the community wiki page for the ''Xenopus c8h8orf48'' genes. Please feel free to record here any relevant information that is not recorded elsewhere o..." current
- 14:4514:45, 26 May 2023 diff hist +476 XB-FEAT-487541 →c6orf136 current
- 14:4314:43, 26 May 2023 diff hist +455 XB-FEAT-5907399 →nomenclature changes current
- 14:3814:38, 26 May 2023 diff hist +443 XB-FEAT-1000743 →nomenclature changes
- 14:3714:37, 26 May 2023 diff hist +5 XB-FEAT-1000743 →c8h14orf39
- 14:2914:29, 26 May 2023 diff hist +488 XB-FEAT-1004911 →c1orf50 current
- 14:2614:26, 26 May 2023 diff hist +479 XB-FEAT-5804717 →c1orf159 current
25 May 2023
- 15:2915:29, 25 May 2023 diff hist +168 XB-FEAT-22068108 →nomenclature changes current
- 15:2815:28, 25 May 2023 diff hist +469 XB-FEAT-22068108 →orthology inference from protein sequence
- 15:2715:27, 25 May 2023 diff hist +1,039 N XB-FEAT-22068108 Created page with " =orthology inference from protein sequence= the Xtrop protein accession XP_031756970.1 matches C3orf62 genes in DIOPT/EggNog Orthologs group, with 67 proteins in 67 specie..."
- 15:0115:01, 25 May 2023 diff hist +10 XB-FEAT-980222 →c1orf87 current
- 15:0015:00, 25 May 2023 diff hist +663 XB-FEAT-980222 →c1orf87
- 14:5114:51, 25 May 2023 diff hist +7 XB-FEAT-6041757 →szt2 current
- 14:5014:50, 25 May 2023 diff hist +739 XB-FEAT-6041757 →c1orf84
- 11:4511:45, 25 May 2023 diff hist +2 XB-FEAT-22169681 →c2h1orf216 current
- 11:4511:45, 25 May 2023 diff hist −3 XB-FEAT-22169681 →c2h1orf162l
- 11:4411:44, 25 May 2023 diff hist +151 XB-FEAT-22169681 →nomenclature changes
- 11:2311:23, 25 May 2023 diff hist +290 XB-FEAT-6034916 →c3h15orf61 current
- 11:1911:19, 25 May 2023 diff hist +119 XB-FEAT-5871696 →nomenclature changes current
- 11:1411:14, 25 May 2023 diff hist 0 XB-FEAT-1000743 →nomenclature changes
- 11:1311:13, 25 May 2023 diff hist +91 XB-FEAT-1000743 →nomenclature changes
- 11:1111:11, 25 May 2023 diff hist +201 XB-FEAT-1000743 →c8h14orf39
- 11:0011:00, 25 May 2023 diff hist +131 XB-FEAT-13579858 →nomenclature changes current
- 10:4310:43, 25 May 2023 diff hist +79 XB-FEAT-6047397 →nomenclature changes current
- 10:4110:41, 25 May 2023 diff hist −2 XB-FEAT-6047397 →art5l
- 07:5007:50, 25 May 2023 diff hist +194 XB-FEAT-22068100 →nomenclature changes current
- 07:3207:32, 25 May 2023 diff hist +136 XB-FEAT-995285 →nomenclature changes current
- 07:2707:27, 25 May 2023 diff hist +110 XB-FEAT-1015210 →nomenclature changes current
- 07:1807:18, 25 May 2023 diff hist +114 XB-FEAT-996610 →nomenclature changes current
24 May 2023
- 14:0514:05, 24 May 2023 diff hist +494 XB-FEAT-5886445 →c17orf80
- 12:5712:57, 24 May 2023 diff hist +308 XB-FEAT-1006443 →unnamed
- 12:4012:40, 24 May 2023 diff hist +20 XB-FEAT-6468174 →nomenclature changes current
- 12:3812:38, 24 May 2023 diff hist +579 XB-FEAT-877271 →c10orf88 current
- 11:4811:48, 24 May 2023 diff hist +2 XB-FEAT-25919034 →nomenclature changes current
- 11:4611:46, 24 May 2023 diff hist +2 XB-FEAT-6461374 →nomenclature changes current
- 11:4611:46, 24 May 2023 diff hist +1,112 N XB-FEAT-6461374 Created page with "=''c6h5orf63''= This is the Xenbase wiki page for the ''Xenopus'' ''c6h5orf63'' genes. Please add any relevant information here that is not represented elsewhere on Xenbase...."
- 11:4511:45, 24 May 2023 diff hist +516 XB-FEAT-25919034 →nomenclature changes
- 11:3911:39, 24 May 2023 diff hist −14 XB-FEAT-25919034 →’’c6h5orf63’’
- 11:3811:38, 24 May 2023 diff hist +481 XB-FEAT-25919034 →nomenclature changes
- 11:3611:36, 24 May 2023 diff hist 0 XB-FEAT-25919034 →’’gene symbol’’
- 11:3611:36, 24 May 2023 diff hist +349 N XB-FEAT-25919034 Created page with "=’’gene symbol’’= This is the Xenbase wiki page for the ‘’Xenopus’’ ‘symbol’’ genes. Please add any relevant information here that is not represented e..."
- 11:2611:26, 24 May 2023 diff hist +2,761 XB-FEAT-1221158 →orthology & synteny
- 11:1811:18, 24 May 2023 diff hist +1,454 XB-FEAT-1221158 →nomenclature changes
- 11:1511:15, 24 May 2023 diff hist −2 XB-FEAT-1221158 →ift70a
- 11:1011:10, 24 May 2023 diff hist +21 XB-FEAT-991164 →nomenclature changes current
- 11:0411:04, 24 May 2023 diff hist −122 XB-FEAT-991164 →nomenclature changes
- 11:0111:01, 24 May 2023 diff hist +576 XB-FEAT-991164 →a4galtl
- 10:3810:38, 24 May 2023 diff hist +1 XB-FEAT-946778 →nomenclature changes current
- 10:3810:38, 24 May 2023 diff hist −1 XB-FEAT-946778 →c3h15orf40
- 10:3710:37, 24 May 2023 diff hist +764 XB-FEAT-946778 →c15orf40
- 08:2908:29, 24 May 2023 diff hist +47 XB-FEAT-5854936 →nomenclature changes current
- 08:2808:28, 24 May 2023 diff hist +45 XB-FEAT-5956503 →nomenclature changes current
- 07:4707:47, 24 May 2023 diff hist −9 XB-FEAT-25874677 →’’il9’’ current
- 07:4707:47, 24 May 2023 diff hist −100 XB-FEAT-25874677 →nomenclature notes
- 07:4307:43, 24 May 2023 diff hist +30 XB-FEAT-25874677 →synteny
- 07:4207:42, 24 May 2023 diff hist +1,282 XB-FEAT-25874677 →nomenclature notes
- 07:2407:24, 24 May 2023 diff hist +208 N XB-FEAT-25874677 Created page with " =’’il9’’= This is the Xenbase wiki page for the ‘’Xenopus’’ ‘il9’’ genes. Please add any relevant information here that is not represented elsewhere o..."
23 May 2023
- 09:5109:51, 23 May 2023 diff hist −121 XB-FEAT-952810 →nomenclature changes current
- 09:5109:51, 23 May 2023 diff hist +5 XB-FEAT-952810 →prfprl2.2
- 09:3209:32, 23 May 2023 diff hist 0 XB-FEAT-952810 →nomenclature changes
- 09:3109:31, 23 May 2023 diff hist +139 XB-FEAT-952810 →loc100486271
- 09:1909:19, 23 May 2023 diff hist +315 N XB-FEAT-22164440 Created page with "=''prfprl2''= This is the Xenbase wiki page for the ''Xenopus prfprl2'' genes. Please add any relevant information here that is not represented elsewhere on Xenbase. =nomen..." current
- 08:2808:28, 23 May 2023 diff hist +233 XB-FEAT-485690 →nomenclature history current
- 08:2608:26, 23 May 2023 diff hist +252 XB-FEAT-5995151 →nomenclature changes current
- 07:2607:26, 23 May 2023 diff hist +567 N XB-FEAT-22250296 Created page with "=''mt-atp8''= This is the Xenbase wiki for ''Xenopus'' ''mt-atp8'' genes. Please feel free to add any information relevant to these genes that is not captured elsewhere on Xe..." current
22 May 2023
- 14:1714:17, 22 May 2023 diff hist +14 XB-FEAT-940519 →synteny and orthology current
- 14:1614:16, 22 May 2023 diff hist +2,088 XB-FEAT-940519 →Nomenclature changes
- 13:1713:17, 22 May 2023 diff hist +126 XB-FEAT-966301 →pak2 current
- 13:1313:13, 22 May 2023 diff hist −12 XB-FEAT-940519 →loc100489062
- 13:0913:09, 22 May 2023 diff hist +799 XB-FEAT-994497 →loc100487024 current
- 13:0213:02, 22 May 2023 diff hist +16 XB-FEAT-940377 →orthology and homology groups current
- 13:0113:01, 22 May 2023 diff hist +4 XB-FEAT-940377 →ccnob.4