User contributions for Christina
Jump to navigation
Jump to search
13 July 2023
- 13:2213:22, 13 July 2023 diff hist +548 N XB-FEAT-29098926 Created page with "=''ccnb5''= =nomenclature updates= 05JULY 2023 ''Xenopus'' gene symbol changed from ''LOC394448'' to ''ccnb5''. This change is supported by DIOPT/EggNog analaysis, which m..." current
- 06:5706:57, 13 July 2023 diff hist +295 XB-FEAT-5802730 →nomenclature updates current
- 06:5406:54, 13 July 2023 diff hist −46 XB-FEAT-5802730 →nomenclature changes
- 06:5406:54, 13 July 2023 diff hist +21 XB-FEAT-5802730 →XB5802730 provisional rab10l
11 July 2023
- 15:4815:48, 11 July 2023 diff hist +380 Protocols →Xenopus oocyte cell free extract
- 15:4315:43, 11 July 2023 diff hist +27 Protocols →Protocols published in non-CSHL Journals- click to view-
7 July 2023
- 06:3706:37, 7 July 2023 diff hist +147 XB-FEAT-946621 →nomenclature changes current
- 06:3606:36, 7 July 2023 diff hist −169 XB-FEAT-946621 →nomenclature changes
- 06:3606:36, 7 July 2023 diff hist +5 XB-FEAT-946621 →hif1a
5 July 2023
- 12:3912:39, 5 July 2023 diff hist 0 XB-FEAT-29071333 →atrx2 current
- 08:1808:18, 5 July 2023 diff hist +2 XB-FEAT-22065331 →nomenclature changes current
- 08:1708:17, 5 July 2023 diff hist +80 XB-FEAT-22065331 →nomenclature changes
- 07:4307:43, 5 July 2023 diff hist +209 XB-FEAT-493800 →larp6 current
1 July 2023
- 14:5814:58, 1 July 2023 diff hist −6 XB-FEAT-13579844 →c1h4orf48 current
30 June 2023
- 14:4014:40, 30 June 2023 diff hist +426 XB-FEAT-13579844 →nomenclature changes
- 14:2314:23, 30 June 2023 diff hist +180 XB-FEAT-5767696 →fam120a current
- 14:2114:21, 30 June 2023 diff hist +157 XB-FEAT-6037326 →fam120c current
- 14:1114:11, 30 June 2023 diff hist +180 XB-FEAT-980081 →fam120b current
- 14:0914:09, 30 June 2023 diff hist +176 XB-FEAT-494052 →tubgcp5 current
- 14:0314:03, 30 June 2023 diff hist +175 XB-FEAT-491695 →tubgcp4 current
- 13:5713:57, 30 June 2023 diff hist +174 XB-FEAT-490982 →tubgcp3 current
- 13:5113:51, 30 June 2023 diff hist +175 XB-FEAT-490605 →tubgcp6 current
- 13:4913:49, 30 June 2023 diff hist +168 XB-FEAT-490452 →tubgcp2 current
- 12:2912:29, 30 June 2023 diff hist +307 XB-FEAT-995201 →loc100158538 current
22 June 2023
- 12:1712:17, 22 June 2023 diff hist +4 XB-FEAT-992706 →nomenclature changes current
- 12:1612:16, 22 June 2023 diff hist +1,059 XB-FEAT-992706 →nomenclature changes
- 12:1012:10, 22 June 2023 diff hist +461 XB-FEAT-992706 →ca13
- 12:0212:02, 22 June 2023 diff hist +5 XB-FEAT-992706 →ca13
21 June 2023
- 12:1012:10, 21 June 2023 diff hist +182 XB-FEAT-981838 →exog current
- 11:2711:27, 21 June 2023 diff hist +5 XB-FEAT-5846793 →znf33b current
- 11:2011:20, 21 June 2023 diff hist +676 XB-FEAT-29087790 →RefSeq protein accession current
- 11:1011:10, 21 June 2023 diff hist +589 N XB-FEAT-29087790 Created page with "=RefSeq protein accession= >XP_031760301.1 gastrula zinc finger protein XlCGF26.1-like [Xenopus tropicalis] MRFCSTQNLLIHQRIHTGRSFVCSKCGKYFSHRKILIAHKWVHTGRKPFTCTESNKGFLWNRDLQQH..."
- 11:0811:08, 21 June 2023 diff hist +849 XB-FEAT-29077586 →refSeq protein accession current
- 11:0011:00, 21 June 2023 diff hist +747 N XB-FEAT-29077586 Created page with "=refSeq protein accession= XP_031760308.1 gastrula zinc finger protein XlCGF57.1-like isoform X1 [Xenopus tropicalis] MEINPVMTTVLQTNNNTMSGPTPVTSEVPIESPKTNQLSKGQRPGKPFVCAKCKRRF..."
- 10:5510:55, 21 June 2023 diff hist −1 XB-FEAT-29097482 →nomenclature changes current
- 10:5510:55, 21 June 2023 diff hist +687 N XB-FEAT-29097482 Created page with "=''znf33bl''= This is the community wiki page for ''Xenopus'' ''znf33bl'' genes. Please record here any relenat information that is not captured elsewhere on Xenbase. =nomenc..."
- 10:3810:38, 21 June 2023 diff hist +588 N XB-FEAT-29099066 Created page with "=''znf24l ''= This is the Xenbase wiki page for ''Xenopus '' ''znf24l'' genes. Please record here any relevant information about ''znf24l'' not captured elsewhere on Xenbase...." current
- 10:2710:27, 21 June 2023 diff hist +15 XB-FEAT-29091390 →nomenclature changes current
- 10:2610:26, 21 June 2023 diff hist +439 N XB-FEAT-29091390 Created page with "== =nomenclature changes= 20JUNE2023 ''Xenopus'' gene name changed from ''gastrula zinc finger protein XlCGF8.2DB-like'' to ''zinc finger and SCAN domain containing 32 like''..."
- 07:4007:40, 21 June 2023 diff hist +153 XB-FEAT-6046830 →padi4 current
- 07:3107:31, 21 June 2023 diff hist +155 XB-FEAT-996813 →padi2 current
20 June 2023
- 12:2112:21, 20 June 2023 diff hist +4 XB-FEAT-5789487 →ptgr1 current
- 12:2112:21, 20 June 2023 diff hist +10 XB-FEAT-5789487 →nomenclature updates
- 12:2012:20, 20 June 2023 diff hist −2 XB-FEAT-5789487 →ptgr1.1
17 June 2023
- 19:1319:13, 17 June 2023 diff hist +400 XB-FEAT-482447 →tdgf1
- 19:0919:09, 17 June 2023 diff hist +307 XB-FEAT-5995511 →nomenclature changes current
- 19:0419:04, 17 June 2023 diff hist +151 XB-FEAT-1217654 →bnc1 current
- 19:0119:01, 17 June 2023 diff hist +145 XB-FEAT-953156 →bnc2 current
- 18:5918:59, 17 June 2023 diff hist +135 XB-FEAT-920751 →shox current
- 18:5718:57, 17 June 2023 diff hist +138 XB-FEAT-480992 →shox2 current