All public logs
Jump to navigation
Jump to search
Combined display of all available logs of XenWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).
- 13:48, 7 March 2025 Christina talk contribs created page XB-FEAT-29092562 (Created page with "=''spaca5''= =nomenclature updates= 06MARCH2025 There are 4 genes annotated as 'spaca5' or 'spaca5l' in the v10 Xenopus genome assemblies. Synteny supports this X. tropicalis gene, on Chr8, GENEID as the true ortholog of the human SPACA5 gene. The names of the spaca5 genes on chr10/9_10L will be changed to 'spaca5-like' genes 1 and 2. ''Xenopus'' gene name has been changed from ''sperm acrosome associated 5 like'' to ''sperm acrosome associated 5'', aka ''sperm acros...")
- 14:16, 28 June 2024 Christina talk contribs created page XB-FEAT-29209516 (Created page with "=nomenclature changes= 27june2024 Human name has changed for Entrez Gene: 4671. From NLR family apoptosis inhibitory protein gene 5 to NLR family apoptosis inhibitory protein")
- 14:14, 28 June 2024 Christina talk contribs created page XB-FEAT-29209187 (Created page with "=nomenclature changes= 27JUNE2024 Human name has changed for Entrez Gene: 283254. From ''harbinger transposase derived 1 like'' to ''harbinger transposase derived 1'' Xenopus gene names have been update accordingly.")
- 10:57, 24 May 2024 Christina talk contribs created page XB-FEAT-29077394 (Created page with "=''cirop''= nomenclature changes= 25MAY2024 ''Xenopus'' gene symbol updated from ''lmln2'' to ''cirop''")
- 20:23, 15 December 2023 Christina talk contribs created page XB-FEAT-29099462 (Created page with "=smim38= This is the community wiki page for the gene ''smim38'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase =nomenclature= 15DEC2023 The ''X. laevis'' L gene previously annotated as ''LOC121402925.L'' (Xenbase v10 gene model XBXL10_1g17811) is determined to be the L homeolog of the ''smim38'' gene, due to synteny and sequence similarity with ''X. tropicalis'' ''smim38''.")
- 12:39, 12 September 2023 Christina talk contribs created page XB-FEAT-23659672 (Created page with "=''cxcl8b''=")
- 12:18, 12 September 2023 Christina talk contribs created page XB-FEAT-29208828 (Created page with "=''il18.2''= This is the community wiki page for the gene ''il18.2'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 09:34, 12 September 2023 Christina talk contribs created page XB-FEAT-6460977 (Created page with "=''il22ra1''= This is the community wiki page for the gene ''il22ra1'' please feel free to add any information that is relevant to this gene that is not already captured elsew...")
- 10:06, 11 September 2023 Christina talk contribs created page XB-FEAT-22201451 (Created page with "= flt3lg = This is the community wiki page for the gene ''flt3lg'' please feel free to add any information that is relevant to this gene that is not already captured elsewher...")
- 08:29, 17 August 2023 Christina talk contribs created page XB-FEAT-22068404 (Created page with "=''''= This is the community wiki page for the gene ''vcf1'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in X...")
- 13:47, 26 July 2023 Christina talk contribs created page XB-FEAT-29208211 (Created page with "=''il17a.2''= =nomenclature changes= 27JULY2023 Three genes were annotated in the v10 assembly as ''il17a-like'' on the same section of Chromosome 5L. These have been provis...")
- 13:38, 26 July 2023 Christina talk contribs created page XB-FEAT-29208203 (Created page with "=''il17a''= =nomenclature changes= Three genes were annotated in the v10 assembly as ''il17a-like'' on the same section of Chromosome 5L. These have been provisionally given...")
- 13:20, 26 July 2023 Christina talk contribs created page XB-FEAT-29208219 (Created page with "=''il17a.3''= =nomenclature changes= Three''il17a'' genes were annotated as ''il17a-like'' omn Chromosome 5L/5S. in the ''X. laevis'' v10.1 annotation. These genes are now p...")
- 10:44, 14 July 2023 Christina talk contribs created page XB-FEAT-29079666 (Created page with "=''btnl10'' = This is the community wiki page for the gene ''btnl10'' please feel free to add any information that is relevant to this gene that is not already captured else...")
- 08:42, 14 July 2023 Christina talk contribs created page XB-FEAT-29081262 (Created page with "=''ctss.4''= This is the community wiki page for the ''Xenopus ctss.4'' genes. Please feel free to add any information here, that is relevant to these genes and is not already...")
- 08:23, 14 July 2023 Christina talk contribs created page XB-FEAT-29089970 (Created page with "=''pkn2l.8''= This is the community wiki page for the ''Xenopus pkn2l.8'' genes. Please feel free to add any information here, that is relevant to these genes and is not alrea...")
- 07:57, 14 July 2023 Christina talk contribs created page XB-FEAT-29087614 (Created page with "=''pkn2l.7''= This is the community wiki page for the ''Xenopus pkn2l.7'' genes. Please feel free to add any information here, that is relevant to these genes and is not alre...")
- 07:34, 14 July 2023 Christina talk contribs created page XB-FEAT-29091126 (Created page with " = ''stk38l2'' = This is the community wiki page for the ''Xenopus stk38l2'' genes. Please feel free to add any information here, that is relevant to these genes and is not al...")
- 07:20, 14 July 2023 Christina talk contribs created page XB-FEAT-29089974 (Created page with " =''pkn2l.6''= This is the community wiki page for the ''Xenopus pkn2l.6'' genes. Please feel free to add any information here, that is relevant to these genes and is not alre...")
- 07:06, 14 July 2023 Christina talk contribs created page XB-FEAT-29089902 (Created page with "=''akt1l''= This is the community wiki page for the ''Xenopus'' ''akt1l'' genes. Please feel free to add any information here, that is relevant to these genes and is not alrea...")
- 15:23, 13 July 2023 Christina talk contribs created page XB-FEAT-29079534 (Created page with "=''pkn2l.5''= This is the community wiki page for the ''Xenopus pkn2l.5'' genes. Please feel free to add any information here, that is relevant to these genes and is not alrea...")
- 15:16, 13 July 2023 Christina talk contribs created page XB-FEAT-29089978 (Created page with "=''pkn2l.4''= This is the community wiki page for the Xenopus pkn2l.4 genes. Please feel free to add any information here, that is relevant to these genes and is not already c...")
- 15:10, 13 July 2023 Christina talk contribs created page XB-FEAT-29092170 (Created page with "= '' pkn1l.2'' = This is the community wiki page for the '' Xenopus '' ''pkn1l.2'' genes. Please feel free to add any information here, that is relevant to these genes and...")
- 15:06, 13 July 2023 Christina talk contribs created page XB-FEAT-29091846 (Created page with "= '' pkn1l'' = This is the community wiki page for the '' Xenopus '' ''pkn1l '' genes. Please feel free to add any information here, that is relevant to these genes and is...")
- 14:54, 13 July 2023 Christina talk contribs created page XB-FEAT-29079470 (Created page with "=''pkn2l.3''= This is the community wiki page for the ''Xenopus'' ''pkn2l.3'' genes. Please feel free to add any information here, that is relevant to these genes and is not a...")
- 14:49, 13 July 2023 Christina talk contribs created page XB-FEAT-29091842 (Created page with "= ''pnk2l.2'' = This is the community wiki page for the '' Xenopus' '' ''pnk2l.2'' genes. Please feel free to add any information here, that is relevant to these genes and...")
- 14:38, 13 July 2023 Christina talk contribs created page XB-FEAT-29085518 (Created page with "= pkn2l = This is the community wiki page for the '' Xenopus '' ''pkn2l '' genes. Please feel free to add any information here, that is relevant to these genes and is not al...")
- 14:28, 13 July 2023 Christina talk contribs created page XB-FEAT-29089986 (Created page with "= '' ctss.3'' = This is the community wiki page for the '' Xenopus '' ''ctss.3'' genes. Please feel free to add any information here, that is relevant to these genes and is...")
- 14:14, 13 July 2023 Christina talk contribs created page XB-FEAT-29098998 (Created page with " =protein sequence= XB used this protein accession to characterize this gene: >NP_001076821.2 uncharacterized protein LOC594890 precursor [Xenopus tropicalis] MGFYRQCLIGLFALL...")
- 13:55, 13 July 2023 Christina talk contribs created page XB-FEAT-29098938 (Created page with " =gene nomenclature updates= 13 JULY 2023 ''Xenopus'' gene symbol changed from ''LOC448216'' to ''ctsk.2'' ''Xenopus'' gene from ''cathepsin K (pycnodysostosis)'' to ''cath...")
- 13:42, 13 July 2023 Christina talk contribs created page XB-FEAT-29098762 (Created page with "=''rps6ka4l''= This is the community wiki page for the '' Xenopus '' ''rps6ka4l '' genes. Please feel free to add any information here, that is relevant to these genes but t...")
- 13:22, 13 July 2023 Christina talk contribs created page XB-FEAT-29098926 (Created page with "=''ccnb5''= =nomenclature updates= 05JULY 2023 ''Xenopus'' gene symbol changed from ''LOC394448'' to ''ccnb5''. This change is supported by DIOPT/EggNog analaysis, which m...")
- 11:10, 21 June 2023 Christina talk contribs created page XB-FEAT-29087790 (Created page with "=RefSeq protein accession= >XP_031760301.1 gastrula zinc finger protein XlCGF26.1-like [Xenopus tropicalis] MRFCSTQNLLIHQRIHTGRSFVCSKCGKYFSHRKILIAHKWVHTGRKPFTCTESNKGFLWNRDLQQH...")
- 11:00, 21 June 2023 Christina talk contribs created page XB-FEAT-29077586 (Created page with "=refSeq protein accession= XP_031760308.1 gastrula zinc finger protein XlCGF57.1-like isoform X1 [Xenopus tropicalis] MEINPVMTTVLQTNNNTMSGPTPVTSEVPIESPKTNQLSKGQRPGKPFVCAKCKRRF...")
- 10:55, 21 June 2023 Christina talk contribs created page XB-FEAT-29097482 (Created page with "=''znf33bl''= This is the community wiki page for ''Xenopus'' ''znf33bl'' genes. Please record here any relenat information that is not captured elsewhere on Xenbase. =nomenc...")
- 10:38, 21 June 2023 Christina talk contribs created page XB-FEAT-29099066 (Created page with "=''znf24l ''= This is the Xenbase wiki page for ''Xenopus '' ''znf24l'' genes. Please record here any relevant information about ''znf24l'' not captured elsewhere on Xenbase....")
- 10:26, 21 June 2023 Christina talk contribs created page XB-FEAT-29091390 (Created page with "== =nomenclature changes= 20JUNE2023 ''Xenopus'' gene name changed from ''gastrula zinc finger protein XlCGF8.2DB-like'' to ''zinc finger and SCAN domain containing 32 like''...")
- 16:44, 16 June 2023 Christina talk contribs created page XB-FEAT-22063241 (Created page with "=nomenclature changes= 18JUNE2023 Gene name and symbol was updated from ''XB22063241 provisional ortholog of lymphocyte antigen 6 complex, locus A2'' to ''ly6g6e , lymphocyte...")
- 08:11, 16 June 2023 Christina talk contribs created page XB-FEAT-29093310 (Created page with "=''or5as1''= This is the community wiki page for the ''Xenopus'' ''or5as1'' genes. Please feel free to record here anything relevant to this gene that is not recorded elsewher...")
- 11:14, 15 June 2023 Christina talk contribs created page XB-FEAT-29077890 (Created page with "=cupin1.2= There's a complex evolutionary history of a set of genes including those previously called '''DYNAP''' in the region between C18orf54 and RAB27b. After review fro...")
- 14:45, 8 June 2023 Christina talk contribs created page XB-FEAT-22068128 (Created page with "=''spmip4''= his is the community wiki page for the gene ''spmip4'' please feel free to add any information that is relevant to this gene that is not already captured elsewher...")
- 13:05, 8 June 2023 Christina talk contribs created page XB-FEAT-29071333 (Created page with "=''atrx2''=")
- 10:07, 8 June 2023 Christina talk contribs created page XB-FEAT-22065335 (Created page with "=''msantdl.2 ''= This is the community wiki page for the gene ''msantdl.2 '' please feel free to add any information that is relevant to this gene that is not already capture...")
- 11:56, 7 June 2023 Christina talk contribs created page XB-FEAT-22068619 (Created page with "=''XB22068619 ''= This is the community wiki page for the gene ''XB22068619 '' please feel free to add any information that is relevant to this gene that is not already captu...")
- 11:31, 7 June 2023 Christina talk contribs created page XB-FEAT-25874688 (Created page with "=''trat1l''= This is the community wiki page for the gene ''trat1l'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 11:14, 7 June 2023 Christina talk contribs created page XB-FEAT-22069556 (Created page with "=nomenclature updates= 05 JUNE 2023 ''Xenopus'' gene symbol and gene name has changed for genepage ID: 22069550 From ''mettl7a.3, methyltransferase like 7A, gene 3'' to ''tm...")
- 08:30, 7 June 2023 Christina talk contribs created page XB-FEAT-6464249 (Created page with "=''tektl1''= This is the community wiki page for the gene ''tektl1'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe...")
- 12:53, 6 June 2023 Christina talk contribs created page XB-FEAT-6469233 (Created page with "=nomenclature updates= 05JUNE 2023 Human name has changed for Entrez Gene: 10086. From HERV-H LTR-associating 1 to HHLA1 neighbor of OC90")
- 11:56, 6 June 2023 Christina talk contribs created page XB-FEAT-22065730 (Created page with "=''ocm4.10''= This is the community wiki page for the gene ''ocm4.10'' please feel free to add any information that is relevant to this gene that is not already captured elsew...")
- 11:54, 6 June 2023 Christina talk contribs created page XB-FEAT-22065778 (Created page with "=''ocm4.9''= This is the community wiki page for the gene ''ocm4.9'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe...")