User contributions for Christina
Jump to navigation
Jump to search
14 July 2023
- 09:2809:28, 14 July 2023 diff hist +73 XB-FEAT-990942 →gene models current
- 09:2809:28, 14 July 2023 diff hist +5 XB-FEAT-990942 →kcnh6
- 09:1709:17, 14 July 2023 diff hist +5 XB-FEAT-983103 →kcnh2
- 08:4208:42, 14 July 2023 diff hist +820 N XB-FEAT-29081262 Created page with "=''ctss.4''= This is the community wiki page for the ''Xenopus ctss.4'' genes. Please feel free to add any information here, that is relevant to these genes and is not already..." current
- 08:2308:23, 14 July 2023 diff hist +1,763 N XB-FEAT-29089970 Created page with "=''pkn2l.8''= This is the community wiki page for the ''Xenopus pkn2l.8'' genes. Please feel free to add any information here, that is relevant to these genes and is not alrea..." current
- 07:5707:57, 14 July 2023 diff hist +880 N XB-FEAT-29087614 Created page with "=''pkn2l.7''= This is the community wiki page for the ''Xenopus pkn2l.7'' genes. Please feel free to add any information here, that is relevant to these genes and is not alre..." current
- 07:4407:44, 14 July 2023 diff hist +33 XB-FEAT-29091126 →nomenclature changes current
- 07:4307:43, 14 July 2023 diff hist +166 XB-FEAT-29091126 →nomenclature changes
- 07:3407:34, 14 July 2023 diff hist +667 N XB-FEAT-29091126 Created page with " = ''stk38l2'' = This is the community wiki page for the ''Xenopus stk38l2'' genes. Please feel free to add any information here, that is relevant to these genes and is not al..."
- 07:2007:20, 14 July 2023 diff hist +593 N XB-FEAT-29089974 Created page with " =''pkn2l.6''= This is the community wiki page for the ''Xenopus pkn2l.6'' genes. Please feel free to add any information here, that is relevant to these genes and is not alre..." current
- 07:1607:16, 14 July 2023 diff hist −10 XB-FEAT-29085518 →nomenclature changes current
- 07:1007:10, 14 July 2023 diff hist +168 XB-FEAT-484952 →akt1 current
- 07:0907:09, 14 July 2023 diff hist +2,299 XB-FEAT-484952 →notes on gene function
- 07:0607:06, 14 July 2023 diff hist +2,711 N XB-FEAT-29089902 Created page with "=''akt1l''= This is the community wiki page for the ''Xenopus'' ''akt1l'' genes. Please feel free to add any information here, that is relevant to these genes and is not alrea..." current
13 July 2023
- 15:2315:23, 13 July 2023 diff hist +605 N XB-FEAT-29079534 Created page with "=''pkn2l.5''= This is the community wiki page for the ''Xenopus pkn2l.5'' genes. Please feel free to add any information here, that is relevant to these genes and is not alrea..." current
- 15:1615:16, 13 July 2023 diff hist +604 N XB-FEAT-29089978 Created page with "=''pkn2l.4''= This is the community wiki page for the Xenopus pkn2l.4 genes. Please feel free to add any information here, that is relevant to these genes and is not already c..." current
- 15:1315:13, 13 July 2023 diff hist −17 XB-FEAT-29079470 →nomenclature changes current
- 15:1015:10, 13 July 2023 diff hist +618 N XB-FEAT-29092170 Created page with "= '' pkn1l.2'' = This is the community wiki page for the '' Xenopus '' ''pkn1l.2'' genes. Please feel free to add any information here, that is relevant to these genes and..." current
- 15:0615:06, 13 July 2023 diff hist +2 XB-FEAT-29091846 →orthology current
- 15:0615:06, 13 July 2023 diff hist +611 N XB-FEAT-29091846 Created page with "= '' pkn1l'' = This is the community wiki page for the '' Xenopus '' ''pkn1l '' genes. Please feel free to add any information here, that is relevant to these genes and is..."
- 14:5714:57, 13 July 2023 diff hist +40 XB-FEAT-29079470 →nomenclature changes
- 14:5414:54, 13 July 2023 diff hist +584 N XB-FEAT-29079470 Created page with "=''pkn2l.3''= This is the community wiki page for the ''Xenopus'' ''pkn2l.3'' genes. Please feel free to add any information here, that is relevant to these genes and is not a..."
- 14:5214:52, 13 July 2023 diff hist +4 XB-FEAT-29091842 →orthology current
- 14:5114:51, 13 July 2023 diff hist 0 XB-FEAT-29091842 →orthology
- 14:5114:51, 13 July 2023 diff hist 0 XB-FEAT-29091842 →nomenclature changes
- 14:5114:51, 13 July 2023 diff hist −1 XB-FEAT-29091842 →pnk2l.2
- 14:5014:50, 13 July 2023 diff hist −1 XB-FEAT-29091842 →=orthology
- 14:5014:50, 13 July 2023 diff hist 0 XB-FEAT-29091842 →nomenclature chnages
- 14:4914:49, 13 July 2023 diff hist +616 N XB-FEAT-29091842 Created page with "= ''pnk2l.2'' = This is the community wiki page for the '' Xenopus' '' ''pnk2l.2'' genes. Please feel free to add any information here, that is relevant to these genes and..."
- 14:3914:39, 13 July 2023 diff hist +14 XB-FEAT-29085518 →nomenclature changes
- 14:3914:39, 13 July 2023 diff hist 0 XB-FEAT-29085518 →pkn2l
- 14:3814:38, 13 July 2023 diff hist +4 XB-FEAT-29085518 →pkn2l
- 14:3814:38, 13 July 2023 diff hist +630 N XB-FEAT-29085518 Created page with "= pkn2l = This is the community wiki page for the '' Xenopus '' ''pkn2l '' genes. Please feel free to add any information here, that is relevant to these genes and is not al..."
- 14:2814:28, 13 July 2023 diff hist +401 N XB-FEAT-29089986 Created page with "= '' ctss.3'' = This is the community wiki page for the '' Xenopus '' ''ctss.3'' genes. Please feel free to add any information here, that is relevant to these genes and is..." current
- 14:2014:20, 13 July 2023 diff hist +200 XB-FEAT-29098998 →protein sequence current
- 14:1414:14, 13 July 2023 diff hist +619 N XB-FEAT-29098998 Created page with " =protein sequence= XB used this protein accession to characterize this gene: >NP_001076821.2 uncharacterized protein LOC594890 precursor [Xenopus tropicalis] MGFYRQCLIGLFALL..."
- 14:0814:08, 13 July 2023 diff hist +4 XB-FEAT-986811 →ctsk.3 current
- 14:0714:07, 13 July 2023 diff hist +200 XB-FEAT-986811 →loc100490139
- 13:5513:55, 13 July 2023 diff hist +368 N XB-FEAT-29098938 Created page with " =gene nomenclature updates= 13 JULY 2023 ''Xenopus'' gene symbol changed from ''LOC448216'' to ''ctsk.2'' ''Xenopus'' gene from ''cathepsin K (pycnodysostosis)'' to ''cath..." current
- 13:4213:42, 13 July 2023 diff hist +467 N XB-FEAT-29098762 Created page with "=''rps6ka4l''= This is the community wiki page for the '' Xenopus '' ''rps6ka4l '' genes. Please feel free to add any information here, that is relevant to these genes but t..." current
- 13:2213:22, 13 July 2023 diff hist +548 N XB-FEAT-29098926 Created page with "=''ccnb5''= =nomenclature updates= 05JULY 2023 ''Xenopus'' gene symbol changed from ''LOC394448'' to ''ccnb5''. This change is supported by DIOPT/EggNog analaysis, which m..." current
- 06:5706:57, 13 July 2023 diff hist +295 XB-FEAT-5802730 →nomenclature updates current
- 06:5406:54, 13 July 2023 diff hist −46 XB-FEAT-5802730 →nomenclature changes
- 06:5406:54, 13 July 2023 diff hist +21 XB-FEAT-5802730 →XB5802730 provisional rab10l
11 July 2023
- 15:4815:48, 11 July 2023 diff hist +380 Protocols →Xenopus oocyte cell free extract
- 15:4315:43, 11 July 2023 diff hist +27 Protocols →Protocols published in non-CSHL Journals- click to view-
7 July 2023
- 06:3706:37, 7 July 2023 diff hist +147 XB-FEAT-946621 →nomenclature changes current
- 06:3606:36, 7 July 2023 diff hist −169 XB-FEAT-946621 →nomenclature changes
- 06:3606:36, 7 July 2023 diff hist +5 XB-FEAT-946621 →hif1a
5 July 2023
- 12:3912:39, 5 July 2023 diff hist 0 XB-FEAT-29071333 →atrx2 current
- 08:1808:18, 5 July 2023 diff hist +2 XB-FEAT-22065331 →nomenclature changes current
- 08:1708:17, 5 July 2023 diff hist +80 XB-FEAT-22065331 →nomenclature changes
- 07:4307:43, 5 July 2023 diff hist +209 XB-FEAT-493800 →larp6 current
1 July 2023
- 14:5814:58, 1 July 2023 diff hist −6 XB-FEAT-13579844 →c1h4orf48 current
30 June 2023
- 14:4014:40, 30 June 2023 diff hist +426 XB-FEAT-13579844 →nomenclature changes
- 14:2314:23, 30 June 2023 diff hist +180 XB-FEAT-5767696 →fam120a current
- 14:2114:21, 30 June 2023 diff hist +157 XB-FEAT-6037326 →fam120c current
- 14:1114:11, 30 June 2023 diff hist +180 XB-FEAT-980081 →fam120b current
- 14:0914:09, 30 June 2023 diff hist +176 XB-FEAT-494052 →tubgcp5 current
- 14:0314:03, 30 June 2023 diff hist +175 XB-FEAT-491695 →tubgcp4 current
- 13:5713:57, 30 June 2023 diff hist +174 XB-FEAT-490982 →tubgcp3 current
- 13:5113:51, 30 June 2023 diff hist +175 XB-FEAT-490605 →tubgcp6 current
- 13:4913:49, 30 June 2023 diff hist +168 XB-FEAT-490452 →tubgcp2 current
- 12:2912:29, 30 June 2023 diff hist +307 XB-FEAT-995201 →loc100158538 current
22 June 2023
- 12:1712:17, 22 June 2023 diff hist +4 XB-FEAT-992706 →nomenclature changes current
- 12:1612:16, 22 June 2023 diff hist +1,059 XB-FEAT-992706 →nomenclature changes
- 12:1012:10, 22 June 2023 diff hist +461 XB-FEAT-992706 →ca13
- 12:0212:02, 22 June 2023 diff hist +5 XB-FEAT-992706 →ca13
21 June 2023
- 12:1012:10, 21 June 2023 diff hist +182 XB-FEAT-981838 →exog current
- 11:2711:27, 21 June 2023 diff hist +5 XB-FEAT-5846793 →znf33b current
- 11:2011:20, 21 June 2023 diff hist +676 XB-FEAT-29087790 →RefSeq protein accession current
- 11:1011:10, 21 June 2023 diff hist +589 N XB-FEAT-29087790 Created page with "=RefSeq protein accession= >XP_031760301.1 gastrula zinc finger protein XlCGF26.1-like [Xenopus tropicalis] MRFCSTQNLLIHQRIHTGRSFVCSKCGKYFSHRKILIAHKWVHTGRKPFTCTESNKGFLWNRDLQQH..."
- 11:0811:08, 21 June 2023 diff hist +849 XB-FEAT-29077586 →refSeq protein accession current
- 11:0011:00, 21 June 2023 diff hist +747 N XB-FEAT-29077586 Created page with "=refSeq protein accession= XP_031760308.1 gastrula zinc finger protein XlCGF57.1-like isoform X1 [Xenopus tropicalis] MEINPVMTTVLQTNNNTMSGPTPVTSEVPIESPKTNQLSKGQRPGKPFVCAKCKRRF..."
- 10:5510:55, 21 June 2023 diff hist −1 XB-FEAT-29097482 →nomenclature changes current
- 10:5510:55, 21 June 2023 diff hist +687 N XB-FEAT-29097482 Created page with "=''znf33bl''= This is the community wiki page for ''Xenopus'' ''znf33bl'' genes. Please record here any relenat information that is not captured elsewhere on Xenbase. =nomenc..."
- 10:3810:38, 21 June 2023 diff hist +588 N XB-FEAT-29099066 Created page with "=''znf24l ''= This is the Xenbase wiki page for ''Xenopus '' ''znf24l'' genes. Please record here any relevant information about ''znf24l'' not captured elsewhere on Xenbase...." current
- 10:2710:27, 21 June 2023 diff hist +15 XB-FEAT-29091390 →nomenclature changes current
- 10:2610:26, 21 June 2023 diff hist +439 N XB-FEAT-29091390 Created page with "== =nomenclature changes= 20JUNE2023 ''Xenopus'' gene name changed from ''gastrula zinc finger protein XlCGF8.2DB-like'' to ''zinc finger and SCAN domain containing 32 like''..."
- 07:4007:40, 21 June 2023 diff hist +153 XB-FEAT-6046830 →padi4 current
- 07:3107:31, 21 June 2023 diff hist +155 XB-FEAT-996813 →padi2 current
20 June 2023
- 12:2112:21, 20 June 2023 diff hist +4 XB-FEAT-5789487 →ptgr1 current
- 12:2112:21, 20 June 2023 diff hist +10 XB-FEAT-5789487 →nomenclature updates
- 12:2012:20, 20 June 2023 diff hist −2 XB-FEAT-5789487 →ptgr1.1
17 June 2023
- 19:1319:13, 17 June 2023 diff hist +400 XB-FEAT-482447 →tdgf1
- 19:0919:09, 17 June 2023 diff hist +307 XB-FEAT-5995511 →nomenclature changes current
- 19:0419:04, 17 June 2023 diff hist +151 XB-FEAT-1217654 →bnc1 current
- 19:0119:01, 17 June 2023 diff hist +145 XB-FEAT-953156 →bnc2 current
- 18:5918:59, 17 June 2023 diff hist +135 XB-FEAT-920751 →shox current
- 18:5718:57, 17 June 2023 diff hist +138 XB-FEAT-480992 →shox2 current
16 June 2023
- 16:4416:44, 16 June 2023 diff hist +15 XB-FEAT-22063241 →nomenclature changes current
- 16:4416:44, 16 June 2023 diff hist +440 N XB-FEAT-22063241 Created page with "=nomenclature changes= 18JUNE2023 Gene name and symbol was updated from ''XB22063241 provisional ortholog of lymphocyte antigen 6 complex, locus A2'' to ''ly6g6e , lymphocyte..."
- 10:3310:33, 16 June 2023 diff hist +4 XB-FEAT-491910 →il17bl current
- 10:3310:33, 16 June 2023 diff hist +137 XB-FEAT-491910 →il17bl
- 08:1108:11, 16 June 2023 diff hist +1 XB-FEAT-29093310 →nomenclature changes current
- 08:1108:11, 16 June 2023 diff hist +385 N XB-FEAT-29093310 Created page with "=''or5as1''= This is the community wiki page for the ''Xenopus'' ''or5as1'' genes. Please feel free to record here anything relevant to this gene that is not recorded elsewher..."
15 June 2023
- 11:3911:39, 15 June 2023 diff hist +11 XB-FEAT-950176 →gene annotation corrections current
- 11:3511:35, 15 June 2023 diff hist +10 XB-FEAT-960657 →gene annotation corrections current
- 11:1611:16, 15 June 2023 diff hist +25 XB-FEAT-29077890 →cupin1.2 current
- 11:1411:14, 15 June 2023 diff hist +1,432 N XB-FEAT-29077890 Created page with "=cupin1.2= There's a complex evolutionary history of a set of genes including those previously called '''DYNAP''' in the region between C18orf54 and RAB27b. After review fro..."