All public logs
Jump to navigation
Jump to search
Combined display of all available logs of XenWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).
- 20:23, 15 December 2023 Christina talk contribs created page XB-FEAT-29099462 (Created page with "=smim38= This is the community wiki page for the gene ''smim38'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase =nomenclature= 15DEC2023 The ''X. laevis'' L gene previously annotated as ''LOC121402925.L'' (Xenbase v10 gene model XBXL10_1g17811) is determined to be the L homeolog of the ''smim38'' gene, due to synteny and sequence similarity with ''X. tropicalis'' ''smim38''.")
- 12:39, 12 September 2023 Christina talk contribs created page XB-FEAT-23659672 (Created page with "=''cxcl8b''=")
- 12:18, 12 September 2023 Christina talk contribs created page XB-FEAT-29208828 (Created page with "=''il18.2''= This is the community wiki page for the gene ''il18.2'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 09:34, 12 September 2023 Christina talk contribs created page XB-FEAT-6460977 (Created page with "=''il22ra1''= This is the community wiki page for the gene ''il22ra1'' please feel free to add any information that is relevant to this gene that is not already captured elsew...")
- 10:06, 11 September 2023 Christina talk contribs created page XB-FEAT-22201451 (Created page with "= flt3lg = This is the community wiki page for the gene ''flt3lg'' please feel free to add any information that is relevant to this gene that is not already captured elsewher...")
- 08:29, 17 August 2023 Christina talk contribs created page XB-FEAT-22068404 (Created page with "=''''= This is the community wiki page for the gene ''vcf1'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in X...")
- 13:47, 26 July 2023 Christina talk contribs created page XB-FEAT-29208211 (Created page with "=''il17a.2''= =nomenclature changes= 27JULY2023 Three genes were annotated in the v10 assembly as ''il17a-like'' on the same section of Chromosome 5L. These have been provis...")
- 13:38, 26 July 2023 Christina talk contribs created page XB-FEAT-29208203 (Created page with "=''il17a''= =nomenclature changes= Three genes were annotated in the v10 assembly as ''il17a-like'' on the same section of Chromosome 5L. These have been provisionally given...")
- 13:20, 26 July 2023 Christina talk contribs created page XB-FEAT-29208219 (Created page with "=''il17a.3''= =nomenclature changes= Three''il17a'' genes were annotated as ''il17a-like'' omn Chromosome 5L/5S. in the ''X. laevis'' v10.1 annotation. These genes are now p...")
- 10:44, 14 July 2023 Christina talk contribs created page XB-FEAT-29079666 (Created page with "=''btnl10'' = This is the community wiki page for the gene ''btnl10'' please feel free to add any information that is relevant to this gene that is not already captured else...")
- 08:42, 14 July 2023 Christina talk contribs created page XB-FEAT-29081262 (Created page with "=''ctss.4''= This is the community wiki page for the ''Xenopus ctss.4'' genes. Please feel free to add any information here, that is relevant to these genes and is not already...")
- 08:23, 14 July 2023 Christina talk contribs created page XB-FEAT-29089970 (Created page with "=''pkn2l.8''= This is the community wiki page for the ''Xenopus pkn2l.8'' genes. Please feel free to add any information here, that is relevant to these genes and is not alrea...")
- 07:57, 14 July 2023 Christina talk contribs created page XB-FEAT-29087614 (Created page with "=''pkn2l.7''= This is the community wiki page for the ''Xenopus pkn2l.7'' genes. Please feel free to add any information here, that is relevant to these genes and is not alre...")
- 07:34, 14 July 2023 Christina talk contribs created page XB-FEAT-29091126 (Created page with " = ''stk38l2'' = This is the community wiki page for the ''Xenopus stk38l2'' genes. Please feel free to add any information here, that is relevant to these genes and is not al...")
- 07:20, 14 July 2023 Christina talk contribs created page XB-FEAT-29089974 (Created page with " =''pkn2l.6''= This is the community wiki page for the ''Xenopus pkn2l.6'' genes. Please feel free to add any information here, that is relevant to these genes and is not alre...")
- 07:06, 14 July 2023 Christina talk contribs created page XB-FEAT-29089902 (Created page with "=''akt1l''= This is the community wiki page for the ''Xenopus'' ''akt1l'' genes. Please feel free to add any information here, that is relevant to these genes and is not alrea...")
- 15:23, 13 July 2023 Christina talk contribs created page XB-FEAT-29079534 (Created page with "=''pkn2l.5''= This is the community wiki page for the ''Xenopus pkn2l.5'' genes. Please feel free to add any information here, that is relevant to these genes and is not alrea...")
- 15:16, 13 July 2023 Christina talk contribs created page XB-FEAT-29089978 (Created page with "=''pkn2l.4''= This is the community wiki page for the Xenopus pkn2l.4 genes. Please feel free to add any information here, that is relevant to these genes and is not already c...")
- 15:10, 13 July 2023 Christina talk contribs created page XB-FEAT-29092170 (Created page with "= '' pkn1l.2'' = This is the community wiki page for the '' Xenopus '' ''pkn1l.2'' genes. Please feel free to add any information here, that is relevant to these genes and...")
- 15:06, 13 July 2023 Christina talk contribs created page XB-FEAT-29091846 (Created page with "= '' pkn1l'' = This is the community wiki page for the '' Xenopus '' ''pkn1l '' genes. Please feel free to add any information here, that is relevant to these genes and is...")
- 14:54, 13 July 2023 Christina talk contribs created page XB-FEAT-29079470 (Created page with "=''pkn2l.3''= This is the community wiki page for the ''Xenopus'' ''pkn2l.3'' genes. Please feel free to add any information here, that is relevant to these genes and is not a...")
- 14:49, 13 July 2023 Christina talk contribs created page XB-FEAT-29091842 (Created page with "= ''pnk2l.2'' = This is the community wiki page for the '' Xenopus' '' ''pnk2l.2'' genes. Please feel free to add any information here, that is relevant to these genes and...")
- 14:38, 13 July 2023 Christina talk contribs created page XB-FEAT-29085518 (Created page with "= pkn2l = This is the community wiki page for the '' Xenopus '' ''pkn2l '' genes. Please feel free to add any information here, that is relevant to these genes and is not al...")
- 14:28, 13 July 2023 Christina talk contribs created page XB-FEAT-29089986 (Created page with "= '' ctss.3'' = This is the community wiki page for the '' Xenopus '' ''ctss.3'' genes. Please feel free to add any information here, that is relevant to these genes and is...")
- 14:14, 13 July 2023 Christina talk contribs created page XB-FEAT-29098998 (Created page with " =protein sequence= XB used this protein accession to characterize this gene: >NP_001076821.2 uncharacterized protein LOC594890 precursor [Xenopus tropicalis] MGFYRQCLIGLFALL...")
- 13:55, 13 July 2023 Christina talk contribs created page XB-FEAT-29098938 (Created page with " =gene nomenclature updates= 13 JULY 2023 ''Xenopus'' gene symbol changed from ''LOC448216'' to ''ctsk.2'' ''Xenopus'' gene from ''cathepsin K (pycnodysostosis)'' to ''cath...")
- 13:42, 13 July 2023 Christina talk contribs created page XB-FEAT-29098762 (Created page with "=''rps6ka4l''= This is the community wiki page for the '' Xenopus '' ''rps6ka4l '' genes. Please feel free to add any information here, that is relevant to these genes but t...")
- 13:22, 13 July 2023 Christina talk contribs created page XB-FEAT-29098926 (Created page with "=''ccnb5''= =nomenclature updates= 05JULY 2023 ''Xenopus'' gene symbol changed from ''LOC394448'' to ''ccnb5''. This change is supported by DIOPT/EggNog analaysis, which m...")
- 11:10, 21 June 2023 Christina talk contribs created page XB-FEAT-29087790 (Created page with "=RefSeq protein accession= >XP_031760301.1 gastrula zinc finger protein XlCGF26.1-like [Xenopus tropicalis] MRFCSTQNLLIHQRIHTGRSFVCSKCGKYFSHRKILIAHKWVHTGRKPFTCTESNKGFLWNRDLQQH...")
- 11:00, 21 June 2023 Christina talk contribs created page XB-FEAT-29077586 (Created page with "=refSeq protein accession= XP_031760308.1 gastrula zinc finger protein XlCGF57.1-like isoform X1 [Xenopus tropicalis] MEINPVMTTVLQTNNNTMSGPTPVTSEVPIESPKTNQLSKGQRPGKPFVCAKCKRRF...")
- 10:55, 21 June 2023 Christina talk contribs created page XB-FEAT-29097482 (Created page with "=''znf33bl''= This is the community wiki page for ''Xenopus'' ''znf33bl'' genes. Please record here any relenat information that is not captured elsewhere on Xenbase. =nomenc...")
- 10:38, 21 June 2023 Christina talk contribs created page XB-FEAT-29099066 (Created page with "=''znf24l ''= This is the Xenbase wiki page for ''Xenopus '' ''znf24l'' genes. Please record here any relevant information about ''znf24l'' not captured elsewhere on Xenbase....")
- 10:26, 21 June 2023 Christina talk contribs created page XB-FEAT-29091390 (Created page with "== =nomenclature changes= 20JUNE2023 ''Xenopus'' gene name changed from ''gastrula zinc finger protein XlCGF8.2DB-like'' to ''zinc finger and SCAN domain containing 32 like''...")
- 16:44, 16 June 2023 Christina talk contribs created page XB-FEAT-22063241 (Created page with "=nomenclature changes= 18JUNE2023 Gene name and symbol was updated from ''XB22063241 provisional ortholog of lymphocyte antigen 6 complex, locus A2'' to ''ly6g6e , lymphocyte...")
- 08:11, 16 June 2023 Christina talk contribs created page XB-FEAT-29093310 (Created page with "=''or5as1''= This is the community wiki page for the ''Xenopus'' ''or5as1'' genes. Please feel free to record here anything relevant to this gene that is not recorded elsewher...")
- 11:14, 15 June 2023 Christina talk contribs created page XB-FEAT-29077890 (Created page with "=cupin1.2= There's a complex evolutionary history of a set of genes including those previously called '''DYNAP''' in the region between C18orf54 and RAB27b. After review fro...")
- 14:45, 8 June 2023 Christina talk contribs created page XB-FEAT-22068128 (Created page with "=''spmip4''= his is the community wiki page for the gene ''spmip4'' please feel free to add any information that is relevant to this gene that is not already captured elsewher...")
- 13:05, 8 June 2023 Christina talk contribs created page XB-FEAT-29071333 (Created page with "=''atrx2''=")
- 10:07, 8 June 2023 Christina talk contribs created page XB-FEAT-22065335 (Created page with "=''msantdl.2 ''= This is the community wiki page for the gene ''msantdl.2 '' please feel free to add any information that is relevant to this gene that is not already capture...")
- 11:56, 7 June 2023 Christina talk contribs created page XB-FEAT-22068619 (Created page with "=''XB22068619 ''= This is the community wiki page for the gene ''XB22068619 '' please feel free to add any information that is relevant to this gene that is not already captu...")
- 11:31, 7 June 2023 Christina talk contribs created page XB-FEAT-25874688 (Created page with "=''trat1l''= This is the community wiki page for the gene ''trat1l'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 11:14, 7 June 2023 Christina talk contribs created page XB-FEAT-22069556 (Created page with "=nomenclature updates= 05 JUNE 2023 ''Xenopus'' gene symbol and gene name has changed for genepage ID: 22069550 From ''mettl7a.3, methyltransferase like 7A, gene 3'' to ''tm...")
- 08:30, 7 June 2023 Christina talk contribs created page XB-FEAT-6464249 (Created page with "=''tektl1''= This is the community wiki page for the gene ''tektl1'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe...")
- 12:53, 6 June 2023 Christina talk contribs created page XB-FEAT-6469233 (Created page with "=nomenclature updates= 05JUNE 2023 Human name has changed for Entrez Gene: 10086. From HERV-H LTR-associating 1 to HHLA1 neighbor of OC90")
- 11:56, 6 June 2023 Christina talk contribs created page XB-FEAT-22065730 (Created page with "=''ocm4.10''= This is the community wiki page for the gene ''ocm4.10'' please feel free to add any information that is relevant to this gene that is not already captured elsew...")
- 11:54, 6 June 2023 Christina talk contribs created page XB-FEAT-22065778 (Created page with "=''ocm4.9''= This is the community wiki page for the gene ''ocm4.9'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe...")
- 11:52, 6 June 2023 Christina talk contribs created page XB-FEAT-22065774 (Created page with "=''ocm4.8''= This is the community wiki page for the gene ''ocm4.8'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe...")
- 11:51, 6 June 2023 Christina talk contribs created page XB-FEAT-22065770 (Created page with "=''ocm4.7''= This is the community wiki page for the gene ''ocm4.7'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe...")
- 11:45, 6 June 2023 Christina talk contribs created page XB-FEAT-22065766 (Created page with "=o''cm4.6''= This is the community wiki page for the gene ''ocm4.6'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe...")
- 12:33, 1 June 2023 Christina talk contribs created page XB-FEAT-22041759 (Created page with "=''znf84l''= This is the Xenbase community wiki page for ''Xenopus'' ''znf84l'' genes. Please feel free to add any information here relevant to ''znf84l'' that is not captured...")
- 14:03, 31 May 2023 Christina talk contribs created page XB-FEAT-18006544 (Created page with "=''lrrn1l''= This is teh community wiki page for the ''Xenopus '' ''lrrn1l'' genes. Please feel free to record here any relevant information about ''lrrn1l'' that is not recor...")
- 10:43, 31 May 2023 Christina talk contribs created page XB-FEAT-18006559 (Created page with "=''atp12al''= This is the community wiki page for ''atp12al''. Please fee free to add here any relevant information about this gene that is not represented elsewhere on Xenbas...")
- 12:48, 30 May 2023 Christina talk contribs created page XB-FEAT-25874530 (haus3)
- 14:51, 26 May 2023 Christina talk contribs created page XB-FEAT-6462368 (Created page with "= ''c8h8orf48''= This is the community wiki page for the ''Xenopus c8h8orf48'' genes. Please feel free to record here any relevant information that is not recorded elsewhere o...")
- 15:27, 25 May 2023 Christina talk contribs created page XB-FEAT-22068108 (Created page with " =orthology inference from protein sequence= the Xtrop protein accession XP_031756970.1 matches C3orf62 genes in DIOPT/EggNog Orthologs group, with 67 proteins in 67 specie...")
- 11:46, 24 May 2023 Christina talk contribs created page XB-FEAT-6461374 (Created page with "=''c6h5orf63''= This is the Xenbase wiki page for the ''Xenopus'' ''c6h5orf63'' genes. Please add any relevant information here that is not represented elsewhere on Xenbase....")
- 11:36, 24 May 2023 Christina talk contribs created page XB-FEAT-25919034 (Created page with "=’’gene symbol’’= This is the Xenbase wiki page for the ‘’Xenopus’’ ‘symbol’’ genes. Please add any relevant information here that is not represented e...")
- 07:24, 24 May 2023 Christina talk contribs created page XB-FEAT-25874677 (Created page with " =’’il9’’= This is the Xenbase wiki page for the ‘’Xenopus’’ ‘il9’’ genes. Please add any relevant information here that is not represented elsewhere o...")
- 09:19, 23 May 2023 Christina talk contribs created page XB-FEAT-22164440 (Created page with "=''prfprl2''= This is the Xenbase wiki page for the ''Xenopus prfprl2'' genes. Please add any relevant information here that is not represented elsewhere on Xenbase. =nomen...")
- 07:26, 23 May 2023 Christina talk contribs created page XB-FEAT-22250296 (Created page with "=''mt-atp8''= This is the Xenbase wiki for ''Xenopus'' ''mt-atp8'' genes. Please feel free to add any information relevant to these genes that is not captured elsewhere on Xe...")
- 14:08, 17 May 2023 Christina talk contribs created page XB-FEAT-18386060 (Created page with "=''cyp27a1.3''=")
- 09:24, 16 May 2023 Christina talk contribs created page XB-FEAT-22069202 (Created page with "=nomenclature changes= 16MAY2023 Xenopus gene was renamed, changing from ''sprr3, small proline rich protein 3'' to ''vgf , VGF nerve growth factor inducible''.")
- 08:51, 16 May 2023 Christina talk contribs created page XB-FEAT-29072295 (Created page with "=tmem86al= This is the community wiki page for teh Xenopus ''tmem86al'' genes. Please feel free to enter here any information relevent to these genes that is not found elsewhe...")
- 08:22, 16 May 2023 Christina talk contribs created page NH-3 (Created page with "==Description== NH-3 is an orally active, reversible thyroid hormone receptor (THR) antagonist with an IC50 of 55 nM. NH-3, a derivative of the selective thyromi-metic GC-1,...")
- 12:18, 9 May 2023 Christina talk contribs created page XB-FEAT-6462861 (Created page with "=''il17rel''= thsi is the community wiki page for the ''Xenopus'' ''il17rel'' genes. Please post here any relevant information about these genes that is not found elsewhere o...")
- 11:18, 9 May 2023 Christina talk contribs created page XB-FEAT-6462903 (Created page with "=''il17rc''= This is the community wiki page for the ''Xenopus'' "il17rc'' genes. Please record here any relevant information about these genes that is not recorded elsewhere...")
- 15:08, 5 May 2023 Christina talk contribs created page XB-FEAT-29071357 (Created page with "=''il12b2''= =nomenclature changes= 05MAy2023 Following recommendation from NCBI RefSeq (RSCOM-449) and Zfin, this gene changed its gene symbol and gene name from ''il12bl,...")
- 09:13, 5 May 2023 Christina talk contribs created page XB-FEAT-29072457 (Created page with "=''anln2''= This is the community wiki page for the gene ''anln2'' please feel free to add any information that is relevant to this gene that is not already captured elsewher...")
- 04:36, 2 May 2023 Christina talk contribs created page XB-FEAT-29072461 (Created page with "=''scrt2''= This is the community wiki page for the gene ''scrt2'' please feel free to add any information that is relevant to this gene that is not already captured elsewher...")
- 11:41, 1 May 2023 Christina talk contribs created page XB-FEAT-12564498 (Created page with "=''col11a2.2''= This is the community wiki page for the gene ''col11a2.2''' please feel free to add any information that is relevant to this gene that is not already captured...")
- 10:27, 1 May 2023 Christina talk contribs created page XB-FEAT-22066239 (Created page with "=''trpv4l''= This is the community wiki page for the gene ''trpv4l'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 11:28, 29 April 2023 Christina talk contribs created page XB-FEAT-6462278 (Created page with "=''trim69''= This is the community wiki page for the gene ''trim69'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 11:26, 29 April 2023 Christina talk contribs created page XB-FEAT-22167848 (Created page with "=''trim39l''= This is the community wiki page for the gene ''trim39l'' please feel free to add any information that is relevant to this gene that is not already captured else...")
- 11:21, 29 April 2023 Christina talk contribs created page XB-FEAT-22065906 (Created page with "=''tmprss2''= This is the community wiki page for the gene ''tmprss2'' please feel free to add any information that is relevant to this gene that is not already captured else...")
- 17:00, 28 April 2023 Christina talk contribs created page XB-FEAT-22061153 (Created page with "=''scamp5''= This is the community wiki page for the gene ''scamp5'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 08:59, 28 April 2023 Christina talk contribs created page XB-FEAT-22063326 (Created page with "=''rbm12b''= This is the community wiki page for the gene ''rbm12b'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 07:42, 28 April 2023 Christina talk contribs created page XB-FEAT-6485433 (Created page with "=''tex12''= This is the community wiki page for the gene ''tex12'' please feel free to add any information that is relevant to this gene that is not already captured elsewher...")
- 07:00, 28 April 2023 Christina talk contribs created page XB-FEAT-17329853 (Created page with "=''muc2l''= This is the community wiki page for the gene ''muc2l'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere...")
- 13:21, 26 April 2023 Christina talk contribs created page XB-FEAT-25875147 (Created page with "=''ncr3lg1l''= This is the community wiki page for the gene ''symbol'' please feel free to add any information that is relevant to this gene that is not already captured elsew...")
- 13:07, 26 April 2023 Christina talk contribs created page XB-FEAT-25874694 (Created page with "=''vtcn1.2''= This is the community wiki page for the gene ''vtcn1.2'' please feel free to add any information that is relevant to this gene that is not already captured else...")
- 12:52, 26 April 2023 Christina talk contribs created page XB-FEAT-22063314 (Created page with "=''yrdc''= This is the community wiki page for the gene ''yrdc'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere...")
- 12:40, 26 April 2023 Christina talk contribs created page XB-FEAT-22062350 (Created page with "=''nat2''= This is the community wiki page for the gene ''nat2'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere...")
- 12:29, 26 April 2023 Christina talk contribs created page XB-FEAT-22064859 (Created page with "=''XB22064859''= This is the community wiki page for the gene ''XB22064859'' please feel free to add any information that is relevant to this gene that is not already capture...")
- 12:24, 26 April 2023 Christina talk contribs created page XB-FEAT-22063310 (Created page with " =NOMENCLATURE CHANGES= 26April2023 ''Xenopus'' gene name changed from XB22063310 [provisional] Xenopus laevis cell surface glycoprotein 1-like, to ''spaca5, sperm acrosome a...")
- 11:39, 26 April 2023 Christina talk contribs created page XB-FEAT-23659525 (Created page with "=''pacs3''= This is the community wiki page for the gene ''pacs3'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere...")
- 10:38, 26 April 2023 Christina talk contribs created page XB-FEAT-17329844 (Created page with "=''symbol''= This is the community wiki page for the gene ''symbol'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 10:34, 26 April 2023 Christina talk contribs created page XB-FEAT-29071321 (Created page with "=''inpp1b''= This is the community wiki page for the gene ''inpp1b'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 09:08, 26 April 2023 Christina talk contribs created page XB-FEAT-22169588 (Created page with "=''ptprvl''= This is the community wiki page for the gene ''ptprvl'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe...")
- 08:47, 26 April 2023 Christina talk contribs created page XB-FEAT-23659530 (Created page with "=''marco''= This is the community wiki page for the gene ''marco'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere...")
- 08:45, 26 April 2023 Christina talk contribs created page XB-FEAT-25875133 (Created page with "=''htr3a.2''= This is the community wiki page for the gene ''htr3a.2'' please feel free to add any information that is relevant to this gene that is not already captured elsew...")
- 08:41, 26 April 2023 Christina talk contribs created page XB-FEAT-29071362 (Created page with "= ''mmp21l''= This is the community wiki page for the gene ''mmp21l'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 08:06, 26 April 2023 Christina talk contribs created page XB-FEAT-25874727 (Created page with "=''arhgap20b''= This is the community wiki page for the gene ''arhgap20b'' please feel free to add any information that is relevant to this gene that is not already captured...")
- 08:05, 26 April 2023 Christina talk contribs created page XB-FEAT-29071395 (Created page with "=''nfil3l''= This is the community wiki page for the gene ''nfil3l'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 12:42, 25 April 2023 Christina talk contribs created page XB-FEAT-22063318 (Created page with "=''xicof6.1l ''= This is the community wiki page for the gene ''xicof6.1l '' please feel free to add any information that is relevant to this gene that is not already capture...")
- 12:41, 25 April 2023 Christina talk contribs created page XB-FEAT-29071391 (Created page with "=''ttc39al''= This is the community wiki page for the gene ''ttc39al'' please feel free to add any information that is relevant to this gene that is not already captured else...")
- 12:39, 25 April 2023 Christina talk contribs created page XB-FEAT-22063306 (Created page with "=''btn1a1 ''= This is the community wiki page for the gene ''btn1a1 '' please feel free to add any information that is relevant to this gene that is not already captured else...")
- 11:28, 25 April 2023 Christina talk contribs created page XB-FEAT-22063245 (Created page with "=''fxyd7''= This is the community wiki page for the gene ''fxyd7'' please feel free to add any information that is relevant to this gene that is not already captured elsewher...")
- 10:26, 25 April 2023 Christina talk contribs created page XB-FEAT-29071329 (Created page with "=''scppa2''= This is the community wiki page for the gene ''scppa2'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 10:20, 25 April 2023 Christina talk contribs created page XB-FEAT-18006570 (Created page with "=''lamtor3l''= This is the community wiki page for the gene ''lamtor3l'' please feel free to add any information that is relevant to this gene that is not already captured el...")
- 10:01, 25 April 2023 Christina talk contribs created page XB-FEAT-6495120 (Created page with "=''flt1''= This is the community wiki page for the gene ''flt1'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere...")
- 08:32, 25 April 2023 Christina talk contribs created page XB-FEAT-22065712 (Created page with "=''LOC100496651''= This is the community wiki page for the gene ''LOC100496651'' please feel free to add any information that is relevant to this gene that is not already cap...")
- 15:00, 24 April 2023 Christina talk contribs created page XB-FEAT-6538722 (Created page with "=''esr-5''= This is the community wiki page for the gene ''esr-5'' please feel free to add any information that is relevant to this gene that is not already captured elsewher...")
- 12:16, 24 April 2023 Christina talk contribs created page XB-FEAT-13579844 (Created page with "=''symbol''= This is the community wiki page for the gene ''symbol'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 11:56, 24 April 2023 Christina talk contribs created page XB-FEAT-22064755 (Created page with "=''c1h22orf15''= This is the community wiki page for the gene ''c1h22orf15'' please feel free to add any information that is relevant to this gene that is not already capture...")
- 10:25, 24 April 2023 Christina talk contribs created page XB-FEAT-6468174 (Created page with "=''symbol''= This is the community wiki page for the gene ''symbol'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 09:59, 24 April 2023 Christina talk contribs created page XB-FEAT-25874652 (Created page with "=bpil= This is the community wiki page for the gene ''bpil'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in X...")
- 08:39, 20 April 2023 Christina talk contribs created page XB-FEAT-22168636 (Created page with "=tgm3l.2=")
- 07:57, 20 April 2023 Christina talk contribs created page XB-FEAT-6465133 (Created page with "= ''bpifb4''=")
- 11:50, 17 April 2023 Christina talk contribs created page XB-FEAT-22168683 (Created page with "=''acrbp.1''=")
- 10:03, 17 April 2023 Christina talk contribs created page XB-FEAT-22069536 (Created page with "= ''cyp46a1.1'' = =gene nomenclature & synteny= There are 3 named ''Xenopus cyp46a1'' genes, a tadem duplication , ''cyp46a1.1, cyp46a1.2, cyp46a1.3'', all on chr8 [Chr8:90...")
- 08:55, 9 February 2023 Christina talk contribs created page XB-FEAT-25919022 (Created page with "=''zfyve28b''= This is the community wiki page for the gene ''zfyve28b'' please feel free to add any information that is relevant to this gene that is not already captured els...")
- 08:55, 9 February 2023 Christina talk contribs created page XB-FEAT-23659514 (Created page with "=''nell3''= This is the community wiki page for the gene ''nell3'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere...")
- 14:02, 2 February 2023 Christina talk contribs created page XB-FEAT-25919039 (Created page with "=''c1h15orf40''= This is the community wiki page for the gene ''c1h15orf40'' please feel free to add any information that is relevant to this gene that is not already capture...")
- 16:20, 31 January 2023 Christina talk contribs created page XB-FEAT-22201039 (Created page with "=cd8a= =nomenclature changes= 31JAN2023 Human name has changed for Entrez Gene: 925. From CD8a molecule to CD8 subunit alpha")
- 13:44, 31 January 2023 Christina talk contribs created page XB-FEAT-22064220 (Created page with "=''cyp2a6.12''= =nomenlcature changes= based on below analysis, the X. laevis.L model that was repreviously identified and called cyp2a6.12, is now thought to be the cyp2a6.1...")
- 08:25, 26 January 2023 Christina talk contribs created page XB-FEAT-25919015 (Created page with "=''wdcp.2''= This is the community wiki page for the gene ''wdcp.2'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 10:35, 5 January 2023 Christina talk contribs created page XB-FEAT-22065609 (Created page with "= ''sprtn2'' = This is the community wiki page for ''sprtn2'' - please feel free to add any information that is relevant to this gene that is not already captured elsewhere in...")
- 10:18, 5 January 2023 Christina talk contribs created page XB-FEAT-22065605 (Created page with "This is the community wiki page for XB22065605 [provisional:sprtn] - please feel free to add any information that is relevant to this gene that is not already captured elsewhe...")
- 09:53, 5 January 2023 Christina talk contribs created page XB-FEAT-22065613 (Created page with "=''sprtn3''= This is the community wiki page for the gene ''sprtn3'', please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 09:00, 5 January 2023 Christina talk contribs created page XB-FEAT-22065621 (Created page with "=nomenclature notes= 05JAN2023 [cjz] in attempt to give this gene a better gen symbol- looked at NCBI. all NCBi genes with the same name have LOC# symbols, a new symbol base...")
- 07:38, 5 January 2023 Christina talk contribs created page XB-FEAT-22065629 (Created page with "=uncharacterized protein XB22065629= 05JAN2023 =protein identity and function= 04JAN2023 The following protein accessions where run through DIOPT Eggnog to attempt to identif...")
- 14:56, 4 January 2023 Christina talk contribs created page XB-FEAT-22065716 (Created page with "=orthology search= 1) uncharacterized protein LOC100487575 [Xenopus tropicalis] NCBI Reference Sequence: XP_002940652.1 MARPLNDGKPSEPVGNIQVETSHAFPAGVAETPCGRICEQSLPSSHPSTTNHSQ...")
- 14:53, 4 January 2023 Christina talk contribs created page XB-FEAT-22068614 (Created page with "=''relt''= This is the community wiki page for the gene ''relt'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere i...")
- 14:43, 4 January 2023 Christina talk contribs created page XB-FEAT-22068624 (Created page with "= ''fndc3c1l'' = This is the community wiki page for the gene ''fndc3c1l'' please feel free to add any information that is relevant to this gene that is not already captured...")
- 14:15, 4 January 2023 Christina talk contribs created page XB-FEAT-22164552 (Created page with " =''csta''= This is the community wiki page for the gene ''csta'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere...")
- 13:53, 4 January 2023 Christina talk contribs created page XB-FEAT-22166267 (Created page with "=''wdr88l''= =nomenlcature changes= 04JAN2023 gene name changed from ''loc100145065'' to ''WD repeat domain 88 like'' gene symbol changed from ''XB22166267'' to ''wdr88l''...")
- 13:29, 4 January 2023 Christina talk contribs created page XB-FEAT-22166511 (Created page with "=''gpr151''= This is the community wiki page for the gene ''gpr151'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 13:28, 4 January 2023 Christina talk contribs created page XB-FEAT-22169457 (Created page with "=''gpr151''= This is the community wiki page for the gene ''gpr151'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 13:20, 4 January 2023 Christina talk contribs created page XB-FEAT-22167168 (Created page with "=rchy1.2= This is the community wiki page for the ''Xenopus'' gene ''rchy1.2''. Feel free to note here anything about ''rchy1.2'' that is not recorded elsewhere on Xenbase....")
- 12:41, 4 January 2023 Christina talk contribs created page XB-FEAT-22169453 (Created page with "=''mgat2l''= This is the community wiki page for the ''Xenopus'' gene ''mgat2l''.Feel free to record here any notes about ''mgat2l'' that are note found elsewhere on Xenbase....")
- 12:07, 4 January 2023 Christina talk contribs created page XB-FEAT-22169469 (Created page with " =''tcrdl''= This is the community page for the ''Xenopus'' gene ''tcrdl''. Feel free to record here any notes about ''tcrdl'' that are not found elsewhere on Xenbase. =nomen...")
- 11:27, 4 January 2023 Christina talk contribs created page XB-FEAT-22169518 (Created page with "=''wadc8l''= This is the community page for the ''Xenopus'' gene ''wadc8l''. Please feel free to add any relevant information here regarding this gene that is not represented...")
- 11:15, 4 January 2023 Christina talk contribs created page XB-FEAT-22169522 (Created page with "==''mypop2''== This is the community page for the ''Xenopus'' gene ''mypop2'', please make notes here about this gene, noting anything that is not recorded elsewhere on Xenbas...")
- 12:53, 7 December 2022 Christina talk contribs created page XB-FEAT-22064790 (Created page with "=''htr7l''= =annotation notes= 07DEC2022 the gene ID: 101734863 has been deprecated by NCBI, and replaced with gene ID:100486231 for the X. tropicalis ''htr7l'' gene")
- 11:46, 7 December 2022 Christina talk contribs created page XB-FEAT-22068916 (Created page with "=annotation notes= 07DEC2022 The gene model for ''plac8l1'' does not appear in the v10 ''X. tropicalis'' assembly. The Entrez gene ID:101735180 for ''plac8l1'' has subsequ...")
- 10:34, 28 November 2022 Christina talk contribs created page XB-FEAT-23659677 (Created page with "=''cxcl8a.2''= =orthology and nomenclature changes= 28NOV2022 Curartors note: the monthly XB-Entrez gene report from NCBI will flag the following genes, but '''no change i...")
- 14:32, 23 September 2022 Christina talk contribs created page XB-FEAT-22068419 (Created page with "=nomenclature updates= 23Sept2022 Human symbol has changed for genepage ID: 22068419 From fam169b to FAM169BP ( p suffix indicating a pseudogene) ''Xenopus'' gene is unchang...")
- 14:29, 23 September 2022 Christina talk contribs created page XB-FEAT-22068599 (Created page with "=nomenclature updates= 23Sept2022 Human symbol has changed for genepage ID: 22068599 From XB22068599 [provisional] to linc03048 Human symbol has changed for Entrez Gene: 1001...")
- 14:26, 23 September 2022 Christina talk contribs created page XB-FEAT-22065649 (Created page with "=nomenclature updates= 23Sept2022 Human symbol has changed for genepage ID: 22065649 From zbed6cl to ZBED10P, zinc finger BED-type containing 10, pseudogene Xenopus gene nam...")
- 10:43, 8 September 2022 Christina talk contribs created page XB-FEAT-22065597 (Created page with "=nomenclature changes= 8SEPT2022 gene name changed from ''kif28p'' to ''kif28'', removing the 'p', as this is a protein coding gene in ''Xenopus'', and not a psuedogene as i...")
- 12:35, 7 September 2022 Christina talk contribs created page XB-FEAT-6485412 (Created page with "=nomenclature changes= 7SEPT2022 this gene was renamed from ''xfo1-1, zinc finger protein'' to ''znf251l, Zinc finger family member 251 like'' following a alignmant of the pr...")
- 12:11, 7 September 2022 Christina talk contribs created page XB-FEAT-22065601 (Created page with "=''znf783''= This is the community wiki page for the gene ''znf783'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 12:30, 31 August 2022 Christina talk contribs created page XB-FEAT-6485500 (Created page with "==''mt-nd4''== =summary for human MT-ND4 from NCBi and teh AGR= Enables NADH dehydrogenase (ubiquinone) activity. Involved in mitochondrial electron transport, NADH to ubiqui...")
- 09:16, 19 August 2022 Christina talk contribs created page XB-FEAT-25874540 (Created page with "=''mhc2-dmb''= This is the wiki page for ''mhc2-dmb''. Feel free to record here any information that is not found elsewhere on Xenbase. =nomenclature changes= 18AUGUST2022...")
- 11:42, 18 August 2022 Christina talk contribs created page XB-FEAT-22167950 (Created page with "=''mhc1b-uea''= =nomenclature changes= 17August2022 ''Xenopus'' MHC genes are currently under review by Xenbase, Xenopus immunobiologists and the HGNC, these names are there...")