User contributions for Xenbase
Jump to navigation
Jump to search
14 March 2024
- 07:5007:50, 14 March 2024 diff hist +529 XB-FEAT-5870707 →loc100495517 current
- 07:4707:47, 14 March 2024 diff hist +550 XB-FEAT-5848842 →loc619584 current
- 07:4307:43, 14 March 2024 diff hist +537 XB-FEAT-5834337 →unnamed current
- 07:3907:39, 14 March 2024 diff hist +534 XB-FEAT-5952314 →loc100036663 current
- 07:1907:19, 14 March 2024 diff hist +707 N XB-FEAT-29082598 Created page with "=''cyp2k1.2''= This is the community wiki page for ''cyp2k1.2''. Feel free to record here any information relevant to this gene that is not captured elsewhere on Xenbase. =nomenclature changes= 12March2024 'Xenopus'' gene name changed from ''LOC100495200'' to ''cyp2k1.2'' following a assessment of synteny for this region of chr5/5L/5S, which contains are cluster of 30 cytochrome p450 genes. ''Xenopus'' nomenclature rules were applied for duplicated genes, and new gene..." current
- 07:1607:16, 14 March 2024 diff hist +761 N XB-FEAT-29081046 Created page with "=''cyp2g1''= This is the community wiki page for ''cyp2g1''. Feel free to record here any information relevant to this gene that is not captured elsewhere on Xenbase. =nomenclature changes= 12March2024 'Xenopus'' gene name changed from ''LOC100492165, putative inactive cytochrome P450 2G1'' to ''cyp2g1, cytochrome P450 2G1'' following a assessment of synteny for this region of chr5/5L/5S, which contains are cluster of 30 cytochrome p450 genes. ''Xenopus'' nomenclature..." current
- 07:1107:11, 14 March 2024 diff hist −16 XB-FEAT-29082542 →nomenclature changes current
- 07:1007:10, 14 March 2024 diff hist +724 N XB-FEAT-29082542 Created page with "=''cyp2k1.3''= This is the community wiki page for ''cyp2k1.3''. Feel free to record here any information relevant to this gene that is not captured elsewhere on Xenbase. =nomenclature changes= 12March2024 'Xenopus'' gene name changed from ''LOC100494424'' and ''XB5870673'' to ''cyp2k1.7'' following a assessment of synteny for this region of chr5/5L/5S, which contains are cluster of 30 cytochrome p450 genes. ''Xenopus'' nomenclature rules were applied for duplicated ge..."
- 07:0307:03, 14 March 2024 diff hist +308 XB-FEAT-6032722 →cyp2j2 current
13 March 2024
- 13:2613:26, 13 March 2024 diff hist +727 N XB-FEAT-29080474 Created page with "=''cyp2k6.1''= This is the community wiki page for ''cyp2k6.1''. Feel free to record here any information relevant to this gene that is not captured elsewhere on Xenbase. =nomenclature changes= 03.12.2024 'Xenopus'' gene name changed from ''LOC108716384'' and ''LOC100490986'' to ''cyp2k6.1'' following a assessment of synteny for this region of chr5/5L/5S, which contains are cluster of 30 cytochrome p450 genes. ''Xenopus'' nomenclature rules were applied for duplicated..." current
- 13:1913:19, 13 March 2024 diff hist +710 N XB-FEAT-29080766 Created page with "=''cyp2k4.2''= This is the community wiki page for ''cyp2k4.2''. Feel free to record here any information relevant to this gene that is not captured elsewhere on Xenbase. =nomenclature changes= 12March2024 'Xenopus'' gene name changed from LOC100491603(cyp2k4) to ''cyp2k4.2'' following a assessment of synteny for this region of chr5/5L/5S, which contains are cluster of 30 cytochrome p450 genes. ''Xenopus'' nomenclature rules were applied for duplicated genes, and new g..." current
- 13:1213:12, 13 March 2024 diff hist +715 N XB-FEAT-29086002 Created page with "=''cyp2k1.4''= This is the community wiki page for ''cyp2k1.4''. Feel free to record here any information relevant to this gene that is not captured elsewhere on Xenbase. =nomenclature changes= 12.03.2024 'Xenopus'' gene name changed from LOC101732279 (cyp2k1-like) to ''cyp2k1.4'' following a assessment of synteny for this region of chr5/5L/5S, which contains are cluster of 30 cytochrome p450 genes. ''Xenopus'' nomenclature rules were applied for duplicated genes, and..." current
- 13:0913:09, 13 March 2024 diff hist +716 N XB-FEAT-29082450 Created page with "=''cyp2k1.5''= This is the community wiki page for ''cyp2k1.5''. Feel free to record here any information relevant to this gene that is not captured elsewhere on Xenbase. =nomenclature changes= 12March2024 'Xenopus'' gene name changed from LOC100494900 (cyp2k1-like) to ''cyp2k1.5'' following a assessment of synteny for this region of chr5/5L/5S, which contains are cluster of 30 cytochrome p450 genes. ''Xenopus'' nomenclature rules were applied for duplicated genes, and..." current
- 13:0513:05, 13 March 2024 diff hist +715 N XB-FEAT-29082322 Created page with "=''cyp2k1.6''= This is the community wiki page for ''cyp2k1.6''. Feel free to record here any information relevant to this gene that is not captured elsewhere on Xenbase. =nomeclature changes= 12March2024 'Xenopus'' gene name changed from LOC100494741 (cyp2k1-like) to ''cyp2k1.6'' following a assessment of synteny for this region of chr5/5L/5S, which contains are cluster of 30 cytochrome p450 genes. ''Xenopus'' nomenclature rules were applied for duplicated genes, and..." current
- 12:5612:56, 13 March 2024 diff hist −4 XB-FEAT-5870673 →loc100494424 current
- 12:5612:56, 13 March 2024 diff hist +552 XB-FEAT-5870673 →loc100494424
- 12:2812:28, 13 March 2024 diff hist +532 XB-FEAT-5952276 →loc100490476 current
- 11:5111:51, 13 March 2024 diff hist 0 XB-FEAT-29089578 →nomenlcature changes current
- 11:5111:51, 13 March 2024 diff hist −23 XB-FEAT-29089578 →nomenclature changes
- 11:5111:51, 13 March 2024 diff hist +753 N XB-FEAT-29089578 Created page with "=''cyp2k6.5''= =nomenclature changes= This is the community wiki page for ''cyp2k6.5''. Feel free to record here any information relevant to this gene that is not captured elsewhere on Xenbase. =nomenlcature changes= 12March2024 'Xenopus'' gene name changed from ''LOC105947503'' and ''LOC10871722'' to ''cyp2k6.5'' following a assessment of synteny for this region of chr5/5L/5S, which contains are cluster of 30 cytochrome p450 genes, where Xenopus nomenclature rules w..."
- 11:3811:38, 13 March 2024 diff hist +713 N XB-FEAT-29081950 Created page with "=''cyp2k6.3''= This is the community wiki page for ''cyp2k6.3''. Feel free to record here any information relevant to this gene that is not captured elsewhere on Xenbase. =nomenclature changes= 12MARCH2024 'Xenopus'' gene name changed from ''LOC100493928'' to ''cyp2k6.3'' following a assessment of synteny for this region of chr5/5L/5S, which contains are cluster of 30 cytochrome p450 genes, where ''Xenopus'' nomenclature rules were applied for duplicated genes, and ne..." current
- 11:3511:35, 13 March 2024 diff hist +3 XB-FEAT-29082174 →cyp2k6.4 current
- 11:3511:35, 13 March 2024 diff hist +706 N XB-FEAT-29082174 Created page with "=cyp2k6.4= This is the community wiki page for ''cyp2k6.4''. Feel free to record here any information relevant to this gene that is not captured elsewhere on Xenbase. =nomenclature changes= 12MARCH2024 ''Xenopus'' gene name changed from ''LOC100494435'' to ''cyp2k6.4'' following a assessment of synteny for this region of chr5/5L/5S, which contains are cluster of 30 cytochrome p450 genes, where Xenopus nomenclature rules were applied for duplicated genes, and new gene..."
12 March 2024
- 12:2812:28, 12 March 2024 diff hist +4 XB-FEAT-5860806 →prpf39.2 current
- 12:2812:28, 12 March 2024 diff hist +211 XB-FEAT-5860806 →prpf39
- 07:1707:17, 12 March 2024 diff hist +267 XB-FEAT-920746 →cplx4 current
11 March 2024
- 13:4313:43, 11 March 2024 diff hist +3 XB-FEAT-29083966 →opn6bl current
- 13:4313:43, 11 March 2024 diff hist +99 XB-FEAT-29083966 →nomenclature changes
- 13:4113:41, 11 March 2024 diff hist +259 XB-FEAT-29083966 →nomenclature changes
- 12:5612:56, 11 March 2024 diff hist +188 XB-FEAT-22172581 →nomenclature changes current
- 12:5212:52, 11 March 2024 diff hist +4 XB-FEAT-22172581 →dtx3-like
- 11:5311:53, 11 March 2024 diff hist +34 XB-FEAT-990739 →nomenclature changes current
- 11:5111:51, 11 March 2024 diff hist +4 XB-FEAT-990739 →bdh1a
- 11:4611:46, 11 March 2024 diff hist +170 N XB-FEAT-22251716 Created page with "=''klc4''= This is the community wiki page for the ''Xenopus'' 'klc4'' genes. Feel free to record here any relevant information that is not captured elsewhere on Xenbase." current
- 11:2011:20, 11 March 2024 diff hist +256 XB-FEAT-984178 →cyb5r4 current
- 10:4510:45, 11 March 2024 diff hist +951 XB-FEAT-489237 →gjb3 current
- 10:4010:40, 11 March 2024 diff hist +4 XB-FEAT-489237 →gjb3
- 10:3510:35, 11 March 2024 diff hist +106 XB-FEAT-993051 →opn1sw current
- 10:0010:00, 11 March 2024 diff hist +3 XB-FEAT-5957215 →nomenclature updatyes current
- 09:5909:59, 11 March 2024 diff hist +10 XB-FEAT-5957215 →synteny
- 09:5809:58, 11 March 2024 diff hist +64 XB-FEAT-5957215 →synteny
- 09:5309:53, 11 March 2024 diff hist +290 XB-FEAT-5957215 →synteny
- 09:5109:51, 11 March 2024 diff hist +96 XB-FEAT-5957215 →loc100485437
7 March 2024
- 14:4414:44, 7 March 2024 diff hist +124 XB-FEAT-29099390 →nomenclature changes current
- 14:4314:43, 7 March 2024 diff hist +830 N XB-FEAT-29099390 Created page with "=''sdcbp2''= This is the Xenbase wiki page for ''sdcbp2''. Feel free to record here any information not captured elsewhere on Xenbase. =nomenclature changes= =synteny= 05MAR2024 Xtrop: chr10: rv: ''pdyn>. nsfl1c>. fkbp1a> '''sdcbp2'''< snph< tmem74b> psmf1< fam110a<'' Xla.chr9_10L: ''pdyn.L> nsfl1c.L> LOC(lncRNA)< fkbp1a.L>. '''MGC52622'''> snph.L< tmem74b.L> psmf1.L< fam110a.L< scrt2.L>'' Xla.S: ''pdyn.S> nsfl1c.S> fkbp1a.S> snph.S< LOC> fam110a.S<. tmem74b..."
- 14:0114:01, 7 March 2024 diff hist +602 XB-FEAT-5762964 →ephb2 current
- 13:2413:24, 7 March 2024 diff hist +262 XB-FEAT-29081014 →uncharacterized genes LOC108700137 and LOC100492077 current
- 13:1713:17, 7 March 2024 diff hist +3,385 N XB-FEAT-29081014 Created page with "=uncharacterized genes LOC108700137 and LOC100492077= =synteny= Human. X: SLC25A43> SLC25A5> '''STEEP1'''< UBE2A> NKRF< SEPTIN6< ''Xtrop chr8: slc25a43> slc25a5> '''LOC100492077'''> ube2a> nkrt< nkap>'' ''Xla v10 8L: slc25a43.L> slc25a5.L> ... ube2a.L> nkrf.L< septin6.L<'' ''Xla v10 chr8S: LOC# slc25a5.S> '''LOC108700137'''> ube2a.S>. nkrf.S<'' Notes from synteny: ** the gene is NOT PRESENT IN XLA.L sub genome, although LOC108700137 and LOC100492077..."
4 March 2024
- 15:5115:51, 4 March 2024 diff hist −16 XB-FEAT-5892679 →synteny current
- 15:5015:50, 4 March 2024 diff hist −2 XB-FEAT-6035279 →synteny current
- 15:5015:50, 4 March 2024 diff hist +2 XB-FEAT-6035279 →synteny
- 15:4815:48, 4 March 2024 diff hist +2,027 XB-FEAT-6035279 →cerkl
- 15:4815:48, 4 March 2024 diff hist +2,026 XB-FEAT-960159 →cerk current
- 15:4815:48, 4 March 2024 diff hist +6 XB-FEAT-5892679 →synteny
- 15:4715:47, 4 March 2024 diff hist +2,179 XB-FEAT-5892679 →loc779592
- 14:1414:14, 4 March 2024 diff hist +571 N XB-FEAT-29093330 Created page with "=''gp2l''= This is the community wiki page for the gene ''gp2l'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase. =nomenclature changes= 04MAR2024 ''Xenopus'' gene name updated from the non-informative LOC#s to ''gp2l, pancreatic secretory granule membrane major glycoprotein GP2 like'' Note that the v9 Xla L gene model (Calle dLOC101733023) lacked an NCBI/Entrez gene ID, while the v10 model (Gene..." current
- 14:0714:07, 4 March 2024 diff hist +5 XB-FEAT-494394 →slc30a2 current
28 February 2024
- 15:2015:20, 28 February 2024 diff hist −9 XB-FEAT-974042 →c2h21orf62 current
- 15:2015:20, 28 February 2024 diff hist +5 XB-FEAT-974042 →nomenclature changes
- 15:1915:19, 28 February 2024 diff hist +252 XB-FEAT-974042 →nomenclature changes
- 15:1715:17, 28 February 2024 diff hist +181 XB-FEAT-986683 →ccdc40 current
- 15:1615:16, 28 February 2024 diff hist +153 XB-FEAT-5995363 →fut2 current
- 15:1015:10, 28 February 2024 diff hist −5 XB-FEAT-994281 →c3h12orf4 current
- 15:1015:10, 28 February 2024 diff hist +453 XB-FEAT-994281 →nomenclature changes
- 15:0715:07, 28 February 2024 diff hist +6 XB-FEAT-941141 →ccdc113 current
- 15:0615:06, 28 February 2024 diff hist +344 XB-FEAT-941141 →ccdc113
- 15:0215:02, 28 February 2024 diff hist +275 XB-FEAT-5843767 →prkcsh current
27 February 2024
- 12:2612:26, 27 February 2024 diff hist +1,865 XB-FEAT-989938 →nppc current
- 12:2512:25, 27 February 2024 diff hist +1,865 XB-FEAT-487177 →nppb current
- 12:2512:25, 27 February 2024 diff hist +1,865 XB-FEAT-484049 →nppa current
- 12:2412:24, 27 February 2024 diff hist +1,865 XB-FEAT-1012469 →npr3 current
- 12:2412:24, 27 February 2024 diff hist +1,865 XB-FEAT-993190 →npr2 current
- 12:2412:24, 27 February 2024 diff hist +1,865 XB-FEAT-970521 →npr1 current
- 12:2112:21, 27 February 2024 diff hist +408 XB-FEAT-984500 →ostn current
7 February 2024
- 09:2909:29, 7 February 2024 diff hist +65 XB-FEAT-29209259 No edit summary current
- 09:1309:13, 7 February 2024 diff hist +295 N XB-FEAT-29209259 Created page with "=gfod3= There was an assigned model for an ''X. laevis'' ''gfod3.S'' gene but this clashed both in model ID and NCBi gene ID with the ''tp73.S'' gene. Subsequent investigation faored the ''tp73.S'' gene assignment so the model and NCBI gene associateion were removed from ''gfod3.S''. (2/7/2024)"
- 08:4208:42, 7 February 2024 diff hist +1 m XB-FEAT-481418 No edit summary current
- 08:4108:41, 7 February 2024 diff hist +574 XB-FEAT-481418 No edit summary
5 February 2024
- 15:3215:32, 5 February 2024 diff hist +426 N XB-FEAT-29079722 Created page with "=''gucy2dl''= This is the Xenbase wiki page for the ''Xenopus gucy2dl'' gene(s). Please feel free to record here any relevant information that is not captured elsewhere on Xenbase. =nomenclature changes= 05FEB2024 ''Xenopus'' gene symbol change from LOC100489435 to ''gucy2dl''. Note that true ''gucy2d'', the ortholog of the human GUCY2D gene, is on chromosome 3 in ''X. tropicalis'', and this ''like'' gene is on Chr2." current
31 January 2024
- 13:3313:33, 31 January 2024 diff hist −12 XB-FEAT-18006528 →gene function and orthology current Tag: Manual revert
- 13:3313:33, 31 January 2024 diff hist +12 XB-FEAT-18006528 →gene function and orthology Tag: Reverted
- 13:2913:29, 31 January 2024 diff hist +4 XB-FEAT-18006528 →dmw
- 13:2813:28, 31 January 2024 diff hist +70 XB-FEAT-18006528 →gene function
- 13:2813:28, 31 January 2024 diff hist +137 N File:Screenshot 2024-01-31 at 9.06.08 AM.png No edit summary current
- 13:2013:20, 31 January 2024 diff hist −1,627 XB-FEAT-18006528 →gene function
- 12:3412:34, 31 January 2024 diff hist +150 XB-FEAT-5902364 →nomenclature changes current
- 12:3312:33, 31 January 2024 diff hist +157 XB-FEAT-5902364 →unnamed
- 12:2312:23, 31 January 2024 diff hist +368 XB-FEAT-5807236 →unnamed current
- 07:4707:47, 31 January 2024 diff hist +2 XB-FEAT-18006528 →gene function
- 07:4507:45, 31 January 2024 diff hist −67 XB-FEAT-18006528 →gene function
30 January 2024
- 14:4814:48, 30 January 2024 diff hist +4 XB-FEAT-18006528 →dmw
- 14:4814:48, 30 January 2024 diff hist −4 XB-FEAT-18006528 →gene function
- 14:4814:48, 30 January 2024 diff hist +1,179 XB-FEAT-18006528 →gene function
24 January 2024
- 09:1509:15, 24 January 2024 diff hist +189 XB-FEAT-6257520 →polr2a current
- 07:2607:26, 24 January 2024 diff hist +4 XB-FEAT-943402 →mrps27 current
23 January 2024
- 08:2408:24, 23 January 2024 diff hist +231 XB-FEAT-1006613 →rps28p9 current
18 January 2024
- 14:1114:11, 18 January 2024 diff hist +527 Protocols →Protocols published in non-CSHL Journals and from Xenopus labs -click to view- current
16 January 2024
- 10:0210:02, 16 January 2024 diff hist +43 Protocols →RNA solubility, RNA interference (RNAi)
- 10:0110:01, 16 January 2024 diff hist +313 Protocols →RNA interference (RNAi)
- 09:5809:58, 16 January 2024 diff hist −9 Protocols →Xenopus Protocols and Video Demostrations: Online Resources
- 09:4309:43, 16 January 2024 diff hist +199 XB-FEAT-963584 →ism1 current
10 January 2024
- 07:4007:40, 10 January 2024 diff hist +4 XB-FEAT-483563 →rab7a current
8 January 2024
- 08:3008:30, 8 January 2024 diff hist +109 XB-FEAT-1217675 →fibrillin genes in representative non-Mammalian eukaryotes current
- 08:3008:30, 8 January 2024 diff hist +109 XB-FEAT-494556 →fibrillin genes in representative non-Mammalian eukaryotes current
- 08:2908:29, 8 January 2024 diff hist +29 XB-FEAT-954189 →fibrillin genes in representative non-Mammalian eukaryotes current
- 08:2908:29, 8 January 2024 diff hist +79 XB-FEAT-954189 →fibrillin genes in representative non-Mammalian eukaryotes
- 08:1808:18, 8 January 2024 diff hist +5,146 XB-FEAT-1217675 →fbn3
- 08:1808:18, 8 January 2024 diff hist +72 XB-FEAT-954189 →fibrillin genes in representative non-Mammalian eukaryotes
- 08:1708:17, 8 January 2024 diff hist 0 XB-FEAT-494556 →fibrillin genes in representative non-Mammalian eukaryotes
- 08:1608:16, 8 January 2024 diff hist +5,147 XB-FEAT-494556 →fbn2
- 08:1208:12, 8 January 2024 diff hist +200 XB-FEAT-954189 →fibrillin genes in representative non-Mammalian eukaryotes
- 08:1108:11, 8 January 2024 diff hist +4,875 XB-FEAT-954189 →fbn1
- 07:0307:03, 8 January 2024 diff hist +9 N XB-FEAT-22041699 Created page with "=fim-a.1="
3 January 2024
- 15:4415:44, 3 January 2024 diff hist +466 N File:Figure 003.png pattypan 22.03 current
- 15:4415:44, 3 January 2024 diff hist +465 N File:Figure 002.png pattypan 22.03 current
- 15:4315:43, 3 January 2024 diff hist +470 N File:Figure 001.png pattypan 22.03 current
- 15:4315:43, 3 January 2024 diff hist +468 N File:Different terminology for disease terms on pages.jpg pattypan 22.03 current
- 08:3008:30, 3 January 2024 diff hist +2 XB-FEAT-29209255 →nfil3l.2 current
- 08:3008:30, 3 January 2024 diff hist +1,043 N XB-FEAT-29209255 Created page with "=nfil3l.2= This is the Xenbase wiki page for the ''Xenopus nfil3l.2'' genes. Please feel free to record here any information about these genes that is not captured elsewhere on Xenbase. =nomenclature changes= 01JAN2024 The ''Xenopus laevis nfil3l.2.L'', nuclear factor interleukin 3 regulated like gene 2 [NCBI GeneID: 447503] is on Chr4L, [v10 gene model: XBXL10_1g19722] and has been placed here on its own gene page. We can not find any paralogous ''nfil3l.2'' gene..."
2 January 2024
- 09:2709:27, 2 January 2024 diff hist +554 XB-FEAT-988305 →prpf4b current
- 09:1609:16, 2 January 2024 diff hist +310 XB-FEAT-493297 →prpf4 current
18 December 2023
- 12:3112:31, 18 December 2023 diff hist −10 XB-FEAT-5886445 →c10h17orf80 current
- 12:3012:30, 18 December 2023 diff hist +164 XB-FEAT-5886445 →nomenclature changes
14 December 2023
- 13:5713:57, 14 December 2023 diff hist +4 XB-FEAT-22164454 →tff3.5
- 13:5713:57, 14 December 2023 diff hist +399 N XB-FEAT-22164454 Created page with "=tff3.5= This is the Xenbase community wiki page for ''Xenopus ''tff3.5'' genes. Please feel free to record here any relevant information about these ones, that is not already represented on the gene page or elsewhere on Xenbase. =genome annotation notes= 12DEC2023 note that ''tff3.5.S'' is not annoatated on the ''X. laevis'' v10 genome release. We looked, and couldn't find a v10.1 model for it."
11 December 2023
- 11:1911:19, 11 December 2023 diff hist +139 XB-FEAT-29084766 →protein current
- 10:5110:51, 11 December 2023 diff hist +35 XB-FEAT-29084766 →synteny
- 10:4910:49, 11 December 2023 diff hist +289 XB-FEAT-29084766 →homology group analysis via EggNOGG v5
- 10:4810:48, 11 December 2023 diff hist −270 XB-FEAT-29084766 →nomenclature changes
- 10:4810:48, 11 December 2023 diff hist +57 XB-FEAT-29084766 →homology group analysis via EggNOGG v5
- 10:2510:25, 11 December 2023 diff hist 0 XB-FEAT-29084766 →synteny
- 10:2410:24, 11 December 2023 diff hist +501 XB-FEAT-29084766 →homology group analysis via EggNOGG v5
- 10:2410:24, 11 December 2023 diff hist −8 XB-FEAT-29084766 →synteny
- 10:2110:21, 11 December 2023 diff hist +2,020 N XB-FEAT-29084766 Created page with " =protein= uncharacterized protein '''LOC101730711''' [Xenopus tropicalis] NCBI Reference Sequence: XP_017952313.2 >XP_017952313.2 uncharacterized protein LOC101730711 [Xenopus tropicalis] MCHILIFILLFLFLFQRKICEGRGRLSCPAVMGPARLHPFIILLGLFHLFLSSTSAVKVENFTLFEEKLK LEAHTANMIPCVFHTRRRLNPLRVQLEWGKMDKEGYVPLIHLDGNHVRKAAADFGDKYQLFIPQVSQGNC SLVINPMDIADSGTYQVRLRILGKLYEPVPSIEIQVVDQRKVESRAWGKKKTTVPPTTIATVPPGFVDDV QKRLVKIDKMAIIAIILNGVFVGIAILLGVLVFITYRKKSSSGDEENPPKKRKQKGKKEPSDESEESSSS..."
5 December 2023
- 15:2515:25, 5 December 2023 diff hist +1 XB-FEAT-483692 →pax8 current
- 10:3410:34, 5 December 2023 diff hist +14 N XB-FEAT-22169226 Created page with "=''chst9l.2''=" current
- 10:3310:33, 5 December 2023 diff hist −6 XB-FEAT-967555 →chst9l.2 current
- 10:3310:33, 5 December 2023 diff hist +10 XB-FEAT-967555 →chst7
4 December 2023
- 14:5414:54, 4 December 2023 diff hist −6 XB-FEAT-483692 No edit summary Tag: Manual revert
- 14:5314:53, 4 December 2023 diff hist +6 XB-FEAT-483692 No edit summary Tag: Reverted
- 13:4613:46, 4 December 2023 diff hist +1,388 N XB-FEAT-29078026 Created page with "=''chst1l''= =protein > homology group> nomenclature notes= 12.04.2023 protein: carbohydrate sulfotransferase 1 [Xenopus laevis] NCBI Reference Sequence: XP_018107451.1 >XP_018107451.1 carbohydrate sulfotransferase 1 [Xenopus laevis] MECSWKAVVLLVFASLGIQYTAIKSLRTAFKSPCQVMGGESRCFQRDLRDNASRLLCEDLGQVNRKHIIL LATTRSGSSFLGQIFNQNPDIFYLYEPLYHVQRAFTNSSTRMQKQIDRRSLLGAYRDLLHNLYNCDFYFL ENYLRPAPKDHETTSFFRRGASNALCLPPVCEQLHPIEEHLCSKKCRTVNLTLVSKSCHQYKHMAIKTVR IPEINDIRTLVEDPRLNLKVIH..." current
- 13:0113:01, 4 December 2023 diff hist +312 XB-FEAT-960884 →chst6 current
30 November 2023
- 08:2608:26, 30 November 2023 diff hist +3 XB-FEAT-1000743 →synteny map
- 08:2508:25, 30 November 2023 diff hist +179 XB-FEAT-1000743 →synteny map
- 08:2008:20, 30 November 2023 diff hist +813 XB-FEAT-1000743 →synteny map
- 08:2008:20, 30 November 2023 diff hist +815 XB-FEAT-483145 →synteny current
- 07:5107:51, 30 November 2023 diff hist +12 XB-FEAT-1000743 No edit summary
- 07:4907:49, 30 November 2023 diff hist −51 XB-FEAT-1000743 →synteny map
- 07:4607:46, 30 November 2023 diff hist +978 N File:Six6 synteny.png No edit summary current
- 07:4307:43, 30 November 2023 diff hist +751 XB-FEAT-1000743 →nomenclature changes
29 November 2023
- 14:2214:22, 29 November 2023 diff hist −1 XB-FEAT-483145 →six6
- 14:2114:21, 29 November 2023 diff hist +19 XB-FEAT-483145 →synteny
- 14:1614:16, 29 November 2023 diff hist +169 XB-FEAT-483145 →synteny
- 14:1114:11, 29 November 2023 diff hist +132 XB-FEAT-483145 →six6
- 10:1210:12, 29 November 2023 diff hist +1,135 XB-FEAT-6257418 No edit summary current
- 08:1408:14, 29 November 2023 diff hist −385 XB-FEAT-22065720 →Summary from NCBI current
- 08:1308:13, 29 November 2023 diff hist +503 XB-FEAT-22065720 →nomenclature notes
- 08:0908:09, 29 November 2023 diff hist −1 XB-FEAT-22065720 →nomenclature notes
- 08:0908:09, 29 November 2023 diff hist −2 XB-FEAT-22065720 →nomenclature notes
20 November 2023
- 10:5510:55, 20 November 2023 diff hist +995 XB-FEAT-992773 No edit summary current
- 10:0010:00, 20 November 2023 diff hist +38 XB-FEAT-6049731 →Synteny current
- 09:4109:41, 20 November 2023 diff hist +1,353 XB-FEAT-6049731 →gabra6
- 09:0909:09, 20 November 2023 diff hist +416 XB-FEAT-992773 →gabra3
30 October 2023
- 13:2913:29, 30 October 2023 diff hist +1,982 Reporting Bugs →Reporting a bug in Xenbase current
18 October 2023
- 14:3714:37, 18 October 2023 diff hist +1,578 XB-FEAT-5959819 →unnamed current
- 14:3714:37, 18 October 2023 diff hist −753 XB-FEAT-940811 →synteny current Tag: Blanking
- 14:3714:37, 18 October 2023 diff hist −823 XB-FEAT-940811 →nomenclature changes
- 14:3714:37, 18 October 2023 diff hist −190 XB-FEAT-940811 →gpr4l
- 14:2214:22, 18 October 2023 diff hist +4 XB-FEAT-940811 →gpr4l
- 14:2214:22, 18 October 2023 diff hist +16 XB-FEAT-940811 →synteny
- 14:2114:21, 18 October 2023 diff hist +1,565 XB-FEAT-940811 →gpr4
- 14:2114:21, 18 October 2023 diff hist +8 XB-FEAT-5853032 →nomenclature changes current
- 14:1514:15, 18 October 2023 diff hist +14 XB-FEAT-5853032 →nomenclature changes
- 14:1414:14, 18 October 2023 diff hist +1,540 XB-FEAT-5853032 →mgc69520
- 14:1214:12, 18 October 2023 diff hist +108 N File:Screenshot 2023-10-18 at 4.10.09 PM.png No edit summary current
- 13:3813:38, 18 October 2023 diff hist +549 N XB-FEAT-18034121 Created page with "=''rho.2''= This is the community wiki page for the ''Xenopus rho.2'' genes. Please add here any relevant information pertaining to these genes, if it is not represented elsewhere on Xenbase. =annotation and synteny= Note that this gene is a duplicate of the adjacent ''rho'' gene, on Chromosome 4, but is only seen in ''X. laeivs'' L subgenome. In v10 assemblies: ''Xtr.chr4: mbd4< ift122> rho> h1-8> plxnd1<'' ''Xla.4L:mbd4.L< ift122.L> rho.L> '''rho.2.L>''' h1-8.L>..." current
- 12:3012:30, 18 October 2023 diff hist +5 XB-FEAT-1018916 →tmtopn3 current
- 12:3012:30, 18 October 2023 diff hist +18 XB-FEAT-1018916 →gene nomenclature
- 12:1112:11, 18 October 2023 diff hist +496 XB-FEAT-22065720 →summary from NCBI
- 12:0112:01, 18 October 2023 diff hist +174 XB-FEAT-22065720 →opn7a
- 12:0012:00, 18 October 2023 diff hist +392 N XB-FEAT-22065720 Created page with "=opn7a= =summary from NCBI= Predicted to enable G protein-coupled receptor activity and photoreceptor activity. Acts upstream of or within phototransduction. Predicted to be located in membrane. Predicted to be integral component of membrane. Is expressed in several structures, including brain; digestive system; eye; heart; and testis. [provided by Alliance of Genome Resources, Apr 2022]"
- 06:4206:42, 18 October 2023 diff hist +306 XB-FEAT-6076481 →rrh current
17 October 2023
- 13:0213:02, 17 October 2023 diff hist +4 XB-FEAT-29083966 →opn6bl Tag: Manual revert
- 13:0213:02, 17 October 2023 diff hist −4 XB-FEAT-29083966 No edit summary Tags: Manual revert Reverted
- 13:0213:02, 17 October 2023 diff hist +4 XB-FEAT-29083966 →opn6bl Tag: Reverted
- 13:0113:01, 17 October 2023 diff hist +803 N XB-FEAT-29083966 Created page with "= opn6bl= This is the Xenbase wiki page for the Xenopus genes 'opn6bl''. Fee; free to record anything here about these genes a=thata are not recorded elsewhere on Xenbase. =nomenclature changes= 18OCT2023 The gene symbol and names for the opsin gens where updated, provisionally, replacing the ''LOC 100497987, visual pigment-like receptor peropsin'' with ''opn6bl, visual pigment-like receptor peropsin 6b like'', which combines the X.tropicalis gene /protein name with th..."
- 12:2212:22, 17 October 2023 diff hist +1,160 XB-FEAT-1018914 →tmtops current
- 12:2012:20, 17 October 2023 diff hist −6 XB-FEAT-990435 →gene nomenclature current
- 12:1712:17, 17 October 2023 diff hist +1,163 XB-FEAT-1018916 →tmtops.2
- 12:1512:15, 17 October 2023 diff hist −4 XB-FEAT-990435 →gene nomenclature
- 12:1312:13, 17 October 2023 diff hist +3 XB-FEAT-990435 →tmtopn2
- 12:1312:13, 17 October 2023 diff hist +1,160 XB-FEAT-990435 →loc100490436
- 08:3808:38, 17 October 2023 diff hist +1 XB-FEAT-5826965 →LOC373730 current
- 08:0008:00, 17 October 2023 diff hist +63 XB-FEAT-5826965 →nomenclature changes
- 07:4007:40, 17 October 2023 diff hist 0 XB-FEAT-5729392 →mrps36 current
- 07:4007:40, 17 October 2023 diff hist +338 XB-FEAT-5729392 →mrps36
10 October 2023
- 09:4509:45, 10 October 2023 diff hist +13 XB-FEAT-989872 →nomenclature notes current
- 09:4509:45, 10 October 2023 diff hist +288 XB-FEAT-989872 →nomenclature notes
- 08:0308:03, 10 October 2023 diff hist +2,724 N XB-FEAT-22063928 Created page with "=''notch4''= This is the community wiki page for the gene ''notch4'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase. =gene nomenclature and annotation notes= In ''X. laevis'', on chromosome 8L, LOC121397048 is the gene next to ''tap2.L'' and we propose that represents a non-coding fragment of ''notch4''. This annotation was based on BLAST of notch4.S XM_041575228.1, which identified the loci n..." current
9 October 2023
- 14:4914:49, 9 October 2023 diff hist 0 N File:Undefined-4.pdf No edit summary current
- 14:4814:48, 9 October 2023 diff hist 0 N File:Undefined-3.pdf No edit summary current
- 14:4814:48, 9 October 2023 diff hist +1,421 XB-FEAT-22062677 →synteny current
- 14:3814:38, 9 October 2023 diff hist +4 XB-FEAT-22062677 →gja4
- 14:3114:31, 9 October 2023 diff hist +153 XB-FEAT-22062677 →nomenclature changes
- 14:2914:29, 9 October 2023 diff hist +239 XB-FEAT-22062677 →nomenclature
- 14:2414:24, 9 October 2023 diff hist 0 XB-FEAT-22062677 →cx38
- 13:0713:07, 9 October 2023 diff hist +31 XB-FEAT-22062677 →synteny
- 13:0413:04, 9 October 2023 diff hist +18 XB-FEAT-22062677 →nomenclature
- 13:0313:03, 9 October 2023 diff hist +86 XB-FEAT-22062677 →nomenclature
- 13:0213:02, 9 October 2023 diff hist +1,354 N XB-FEAT-22062677 Created page with "=''cx38''= This is the community wiki page for the gene ''cx38'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase. =nomenclature= 09 OCTOBER 2023 Note: no other vertebrate genes are called ''cx38'', just ''X. trop'' GeneID:100170463, and ''X. laevis'' GeneID:397866. The Synonym given is ''gja2'', which in NCBI is currently only assigned to genes in a large number of fish species, but no other vert..."
6 October 2023
- 11:3511:35, 6 October 2023 diff hist +6 Stage 44 No edit summary current
5 October 2023
- 15:1715:17, 5 October 2023 diff hist 0 Stage 44 No edit summary
- 15:1415:14, 5 October 2023 diff hist 0 N File:Stage44ventral.jpg No edit summary current
- 15:1315:13, 5 October 2023 diff hist +4 Stage 44 No edit summary
- 15:1315:13, 5 October 2023 diff hist −1 Stage 44 No edit summary
- 13:2213:22, 5 October 2023 diff hist 0 File:Herbimycin.png Xenbase uploaded File:Herbimycin.png current
- 10:5110:51, 5 October 2023 diff hist 0 File:Krylov FISH-TSA protocol.pdf Xenbase uploaded File:Krylov FISH-TSA protocol.pdf current
- 10:5010:50, 5 October 2023 diff hist 0 File:Slc45a2 - Start Codon - Consensus.pdf Xenbase uploaded File:Slc45a2 - Start Codon - Consensus.pdf current
- 10:5010:50, 5 October 2023 diff hist 0 File:Slc45a2 - tBLASTn.pdf Xenbase uploaded File:Slc45a2 - tBLASTn.pdf current
- 10:4910:49, 5 October 2023 diff hist 0 File:Slc45a2 - Multi-sequence alignment.pdf Xenbase uploaded File:Slc45a2 - Multi-sequence alignment.pdf current
- 07:2107:21, 5 October 2023 diff hist −2 XB-FEAT-966538 →notes on adam11 current
- 07:2107:21, 5 October 2023 diff hist +1,370 XB-FEAT-966538 →synonyms
- 07:1707:17, 5 October 2023 diff hist +5 XB-FEAT-966538 →adam11
3 October 2023
- 07:4707:47, 3 October 2023 diff hist 0 XB-FEAT-487651 →nomenclature changes current
- 07:4707:47, 3 October 2023 diff hist +298 XB-FEAT-487651 →nomenclature changes
- 07:4407:44, 3 October 2023 diff hist +3 XB-FEAT-487651 →il1r1
2 October 2023
- 13:1913:19, 2 October 2023 diff hist +16 XB-FEAT-5765837 →synteny and orthology current
- 13:0813:08, 2 October 2023 diff hist +1 XB-FEAT-993484 →Synteny and v10 model annoation current
- 13:0713:07, 2 October 2023 diff hist +1 XB-FEAT-993484 →Synteny and v10 model annoation
- 13:0613:06, 2 October 2023 diff hist +8 XB-FEAT-993484 →Synteny and v10 model annoation
- 13:0613:06, 2 October 2023 diff hist +634 XB-FEAT-993484 →adam19
- 12:5512:55, 2 October 2023 diff hist +13 XB-FEAT-29085838 →background to resolution of adam13 v adam33 names in Xenopus current
- 12:3512:35, 2 October 2023 diff hist +90 XB-FEAT-12564498 →nomenclature changes current
- 12:3312:33, 2 October 2023 diff hist +2,225 XB-FEAT-12564498 →nomenclature changes
- 12:0412:04, 2 October 2023 diff hist −934 XB-FEAT-12564498 →summary for human COL11A2
- 12:0412:04, 2 October 2023 diff hist +933 XB-FEAT-876668 →nomenclature changes current
- 12:0312:03, 2 October 2023 diff hist +2 XB-FEAT-12564498 →col11a2
- 11:5311:53, 2 October 2023 diff hist +163 XB-FEAT-876668 →nomenclature changes
- 11:4911:49, 2 October 2023 diff hist 0 XB-FEAT-876668 →Orthology and syntey
- 11:4811:48, 2 October 2023 diff hist −1 XB-FEAT-876668 →Orthology and syntey
- 11:4811:48, 2 October 2023 diff hist +1,208 XB-FEAT-876668 →nomenclature changes
- 11:4211:42, 2 October 2023 diff hist −2 XB-FEAT-876668 →col11a2p
- 10:3310:33, 2 October 2023 diff hist +4 XB-FEAT-5748509 →inmt current
- 10:3310:33, 2 October 2023 diff hist +4 XB-FEAT-5814630 →loc100496844 current
- 10:1110:11, 2 October 2023 diff hist +4 XB-FEAT-876668 →col11a2p
- 08:2508:25, 2 October 2023 diff hist +7 XB-FEAT-5889258 →nomenclature changes current
- 08:2308:23, 2 October 2023 diff hist −2 XB-FEAT-5889258 →mhc2-daa.2
- 07:4607:46, 2 October 2023 diff hist +11 XB-FEAT-29093450 →Table: Xenopus cyp27a1 protein accession and name changes current
- 07:4507:45, 2 October 2023 diff hist +1 XB-FEAT-29093450 →cyp27a1.2
- 07:4507:45, 2 October 2023 diff hist +3,963 N XB-FEAT-29093450 Created page with "=''cyp27a1.2''= his is the community wiki page for the gene ''cyp27a1.2'' please feel free to add any information that is relevant to this gene that is not already captured el..."
- 07:3907:39, 2 October 2023 diff hist −4 XB-FEAT-18386060 →cyp27a1.1 current
- 07:0807:08, 2 October 2023 diff hist +174 XB-FEAT-5826965 →nomenclature changes
- 07:0207:02, 2 October 2023 diff hist −9 XB-FEAT-22068060 →c3h12orf40 current
- 07:0207:02, 2 October 2023 diff hist +323 XB-FEAT-22068060 →nomenclature changes
- 06:5406:54, 2 October 2023 diff hist +364 XB-FEAT-5953233 →kiaa2026 current
26 September 2023
- 12:5012:50, 26 September 2023 diff hist +1,736 XB-FEAT-29072384 →b3galt2l.13 current
- 12:5012:50, 26 September 2023 diff hist +30 XB-FEAT-29072327 →nomenclature updates current
- 12:4912:49, 26 September 2023 diff hist +30 XB-FEAT-29072331 →nomenclature updates current
- 12:4812:48, 26 September 2023 diff hist +30 XB-FEAT-29072376 →nomenclature updates current
- 12:4812:48, 26 September 2023 diff hist −24 XB-FEAT-29072323 →nomenclature updates current
- 12:4712:47, 26 September 2023 diff hist −24 XB-FEAT-29072343 →nomenclature updates current
- 12:4612:46, 26 September 2023 diff hist −23 XB-FEAT-29072311 →nomenclature updates current
- 12:4512:45, 26 September 2023 diff hist +2 XB-FEAT-29072339 →nomenclature updates current
- 12:4312:43, 26 September 2023 diff hist +35 XB-FEAT-29072396 →nomenclature updates current
- 12:4212:42, 26 September 2023 diff hist +35 XB-FEAT-29072315 →nomenclature updates current
- 12:4212:42, 26 September 2023 diff hist +35 XB-FEAT-29072356 →nomenclature updates current
- 12:4112:41, 26 September 2023 diff hist +30 XB-FEAT-29072368 →nomenclature updates current
- 12:4012:40, 26 September 2023 diff hist +35 XB-FEAT-29072360 →nomenclature changes current
- 12:3912:39, 26 September 2023 diff hist +1,956 N XB-FEAT-29072323 Created page with "=''b3galt2l.9''= This is the community wiki page for the gene ''b3galt2l.9'' please feel free to add any information that is relevant to this gene that is not already capture..."
- 12:3812:38, 26 September 2023 diff hist +1,956 N XB-FEAT-29072343 Created page with "=''b3galt2l.8''= This is the community wiki page for the gene ''b3galt2l.8'' please feel free to add any information that is relevant to this gene that is not already capture..."
- 12:3712:37, 26 September 2023 diff hist +1,956 N XB-FEAT-29072311 Created page with "=''b3galt2l.7''= This is the community wiki page for the gene ''b3galt2l.7'' please feel free to add any information that is relevant to this gene that is not already capture..."
- 12:3512:35, 26 September 2023 diff hist +1,930 N XB-FEAT-29072339 Created page with "=''b3galt2l.6''= This is the community wiki page for the gene ''b3galt2l.6'' please feel free to add any information that is relevant to this gene that is not already capture..."
- 12:3312:33, 26 September 2023 diff hist +1,902 N XB-FEAT-29072396 Created page with "=''b3galt2l.5''= This is the community wiki page for the gene ''b3galt2l.5'' please feel free to add any information that is relevant to this gene that is not already capture..."
- 12:3212:32, 26 September 2023 diff hist +1,902 N XB-FEAT-29072315 Created page with "=''b3galt2l.4''= This is the community wiki page for the gene ''b3galt2l.4'' please feel free to add any information that is relevant to this gene that is not already capture..."
- 12:3112:31, 26 September 2023 diff hist +1,902 N XB-FEAT-29072356 Created page with "=''b3galt2l.3''= This is the community wiki page for the gene ''b3galt2l.3'' please feel free to add any information that is relevant to this gene that is not already capture..."
- 12:3112:31, 26 September 2023 diff hist +1,902 N XB-FEAT-29072368 Created page with "=''b3galt2l.2''= This is the community wiki page for the gene ''b3galt2l.2'' please feel free to add any information that is relevant to this gene that is not already capture..."
- 12:3012:30, 26 September 2023 diff hist +1,904 N XB-FEAT-29072327 Created page with "=''b3galt2l.12''= This is the community wiki page for the gene ''b3galt2l.12'' please feel free to add any information that is relevant to this gene that is not already captu..."
- 12:3012:30, 26 September 2023 diff hist +1,904 N XB-FEAT-29072331 Created page with "=''b3galt2l.11''= This is the community wiki page for the gene ''b3galt2l.11'' please feel free to add any information that is relevant to this gene that is not already captu..."
- 12:2912:29, 26 September 2023 diff hist +1,904 N XB-FEAT-29072376 Created page with "=''b3galt2l.10''= This is the community wiki page for the gene ''b3galt2l.10'' please feel free to add any information that is relevant to this gene that is not already captu..."
- 12:2812:28, 26 September 2023 diff hist +1,681 XB-FEAT-29072360 →nomenclature changes
- 12:0612:06, 26 September 2023 diff hist +199 N XB-FEAT-29072384 Created page with "=''b3galt2l.13''= This is the community wiki page for the gene ''b3galt2l.13'' please feel free to add any information that is relevant to this gene that is not already captu..."
- 12:0012:00, 26 September 2023 diff hist +4 XB-FEAT-22172613 →b3galt2 current
- 11:4911:49, 26 September 2023 diff hist +3 XB-FEAT-29072360 →b3galt2l.1
- 11:4911:49, 26 September 2023 diff hist +527 N XB-FEAT-29072360 Created page with "=b3galt2l.1= This is the community wiki page for the gene ''b3galt2l.1'' please feel free to add any information that is relevant to this gene that is not already captured els..."
- 11:4911:49, 26 September 2023 diff hist +390 XB-FEAT-5795333 →nomenclature changes current
- 11:1711:17, 26 September 2023 diff hist −189 XB-FEAT-6035125 →kiaa0467 current Tag: Blanking
25 September 2023
- 12:4212:42, 25 September 2023 diff hist −104 XB-FEAT-18386060 →cobalt protein alignment and cladogram
- 12:4112:41, 25 September 2023 diff hist +575 XB-FEAT-18386060 →Synteny pattern
- 12:3612:36, 25 September 2023 diff hist +15 XB-FEAT-18386060 →synteny and orthology
- 12:2312:23, 25 September 2023 diff hist +35 XB-FEAT-18386060 →synteny and orthology
- 12:2212:22, 25 September 2023 diff hist +2 XB-FEAT-18386060 →synteny and orthology
- 12:2012:20, 25 September 2023 diff hist 0 XB-FEAT-18386060 →cyp27a1.3
21 September 2023
- 15:1415:14, 21 September 2023 diff hist +164 XB-FEAT-992649 →nfix current
20 September 2023
- 13:4413:44, 20 September 2023 diff hist +97 XB-FEAT-5813246 →utrn current
- 13:2713:27, 20 September 2023 diff hist +84 XB-FEAT-5732027 →annotation notes current
- 13:2513:25, 20 September 2023 diff hist +1,263 XB-FEAT-5732027 →nomenclature changes
- 13:2213:22, 20 September 2023 diff hist +4 XB-FEAT-5732027 →ctu2
- 10:3510:35, 20 September 2023 diff hist +756 XB-FEAT-984452 →nomenclature changes current
- 07:5507:55, 20 September 2023 diff hist +311 XB-FEAT-5794174 →nomenclature changes
- 07:5107:51, 20 September 2023 diff hist +84 XB-FEAT-6469275 →nomenclature changes current
- 07:5007:50, 20 September 2023 diff hist +586 N XB-FEAT-6469275 Created page with " = ''nhsl3''= This is the community wiki page for the gene ''nhsl3'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe..."
- 07:4407:44, 20 September 2023 diff hist +851 XB-FEAT-6049994 →c20orf117 current
- 07:3507:35, 20 September 2023 diff hist +194 XB-FEAT-942714 →ostalpha current
- 07:3007:30, 20 September 2023 diff hist +508 XB-FEAT-952335 →nomenclature changes current
- 07:2507:25, 20 September 2023 diff hist +238 XB-FEAT-994479 →nomenclature changes current
- 07:2307:23, 20 September 2023 diff hist +467 XB-FEAT-994479 →c6orf174
- 07:1607:16, 20 September 2023 diff hist +520 XB-FEAT-942391 →fam172a current
- 07:0907:09, 20 September 2023 diff hist +137 XB-FEAT-1217450 →nomenclature changes current
- 07:0907:09, 20 September 2023 diff hist +4 XB-FEAT-1217450 →mov10l1
- 07:0707:07, 20 September 2023 diff hist +145 XB-FEAT-483537 →mov10 current
19 September 2023
- 11:4711:47, 19 September 2023 diff hist +1 XB-FEAT-5889258 →Protein Accessions & Sequences in FASTA format
- 11:4611:46, 19 September 2023 diff hist +1 XB-FEAT-5889258 →Protein Accessions & Sequences in FASTA format
- 11:4611:46, 19 September 2023 diff hist +11 XB-FEAT-5889258 →Protein Accessions & Sequences in FASTA format
- 11:4611:46, 19 September 2023 diff hist −41 XB-FEAT-5889258 →nomenclature changes
- 11:4511:45, 19 September 2023 diff hist +123 N File:Mhc2.daa2 msa.png No edit summary current
- 11:4111:41, 19 September 2023 diff hist +2,833 XB-FEAT-5889258 →nomenclature changes
- 11:1111:11, 19 September 2023 diff hist +4 XB-FEAT-5889258 →mhc2-daa
- 08:4708:47, 19 September 2023 diff hist 0 XB-FEAT-6467124 →nomenclature changes current
- 08:0108:01, 19 September 2023 diff hist −2 XB-FEAT-6467139 →synteny and orthology current
- 08:0008:00, 19 September 2023 diff hist 0 XB-FEAT-6467139 →synteny and orthology
- 08:0008:00, 19 September 2023 diff hist +3 XB-FEAT-6467139 →nomenclature changes
- 07:5407:54, 19 September 2023 diff hist +2,783 N XB-FEAT-29081898 Created page with "=''ces2.7''= This is the community wiki page for the gene ''ces2.7'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe..." current
- 07:4007:40, 19 September 2023 diff hist −1 XB-FEAT-29096122 →synteny and orthology current
- 07:3907:39, 19 September 2023 diff hist +437 XB-FEAT-29096122 →nomenclature changes
- 07:2207:22, 19 September 2023 diff hist +862 XB-FEAT-6467132 →nomenclature changes current
- 07:1607:16, 19 September 2023 diff hist +3,123 XB-FEAT-6467132 →nomenclature changes
- 07:1607:16, 19 September 2023 diff hist −1 XB-FEAT-29096122 →synteny and orthology
- 07:1507:15, 19 September 2023 diff hist 0 XB-FEAT-6467132 →ces3.5
- 07:1307:13, 19 September 2023 diff hist +109 XB-FEAT-5765837 →nomenclature changes
18 September 2023
- 16:0716:07, 18 September 2023 diff hist +4,059 N XB-FEAT-29096122 Created page with "=''ces2.5''= This is the community wiki page for the gene ''ces2.5'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe..."
- 15:5915:59, 18 September 2023 diff hist +3,120 XB-FEAT-5765837 →nomenclature changes
- 15:5815:58, 18 September 2023 diff hist 0 XB-FEAT-6467124 →nomenclature changes
- 15:5715:57, 18 September 2023 diff hist +29 XB-FEAT-6467124 →nomenclature changes
- 15:5715:57, 18 September 2023 diff hist +440 XB-FEAT-5765837 →nomenclature changes
- 15:5615:56, 18 September 2023 diff hist +183 XB-FEAT-5765837 →nomenclature changes
- 15:5515:55, 18 September 2023 diff hist 0 XB-FEAT-5765837 →ces3.4
- 15:3515:35, 18 September 2023 diff hist +3,788 N XB-FEAT-29081994 Created page with "=''ces2.2''= This is the community wiki page for the gene ''ces2.2'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe..." current
- 15:3515:35, 18 September 2023 diff hist 0 XB-FEAT-6467124 →protein alignment and phylogenetic anayslis
- 15:1415:14, 18 September 2023 diff hist +1,542 XB-FEAT-6467139 →synteny and orthology
- 15:1415:14, 18 September 2023 diff hist +69 XB-FEAT-6467139 →nomenclature changes
- 15:1315:13, 18 September 2023 diff hist −91 XB-FEAT-6467139 →nomenclature updates
- 15:1315:13, 18 September 2023 diff hist +1,409 XB-FEAT-6467139 →nomenclature changes
- 15:1315:13, 18 September 2023 diff hist +694 XB-FEAT-6467139 →nomenclature changes
- 15:1115:11, 18 September 2023 diff hist +7 XB-FEAT-6467139 →ces3
- 15:1015:10, 18 September 2023 diff hist +411 XB-FEAT-6467124 →nomenclature changes
- 15:0315:03, 18 September 2023 diff hist +230 XB-FEAT-6467124 →nomenclature changes
- 15:0315:03, 18 September 2023 diff hist −197 XB-FEAT-6467124 →nomenclature changes
- 15:0215:02, 18 September 2023 diff hist +18 XB-FEAT-6467124 →synteny and orthology
- 15:0115:01, 18 September 2023 diff hist +3,414 XB-FEAT-6467124 →ces3.7
- 15:0015:00, 18 September 2023 diff hist +119 N File:Screenshot 2023-09-18 at 3.06.15 PM.png No edit summary current
- 12:0312:03, 18 September 2023 diff hist +186 XB-FEAT-6467132 →nomenclature changes
- 10:2010:20, 18 September 2023 diff hist +5 XB-FEAT-5765837 →ces3.4
- 10:0610:06, 18 September 2023 diff hist +1,065 XB-FEAT-1008884 →cdipt current
14 September 2023
- 12:3112:31, 14 September 2023 diff hist +13 XB-FEAT-988106 →synteny current
- 12:3012:30, 14 September 2023 diff hist +1,763 XB-FEAT-988106 →nomenclature changes
- 12:1012:10, 14 September 2023 diff hist +3,139 XB-FEAT-29085838 →nomenclature changes
- 12:0712:07, 14 September 2023 diff hist +1 XB-FEAT-29085838 →nomenclature changes
- 12:0312:03, 14 September 2023 diff hist +49 XB-FEAT-988106 →nomenclature changes
- 12:0312:03, 14 September 2023 diff hist +26 XB-FEAT-988106 →adam33
- 11:5711:57, 14 September 2023 diff hist −1 XB-FEAT-29085838 →synteny
- 11:5611:56, 14 September 2023 diff hist +459 XB-FEAT-29085838 →summary for HUMAN ADAM33 from NCBI
- 08:3508:35, 14 September 2023 diff hist +1,281 N XB-FEAT-29085838 Created page with "=''adam33''= This is the community wiki page for the gene ''adam33'' please feel free to add any information that is relevant to this gene that is not already captured elsewh..."
13 September 2023
- 11:0611:06, 13 September 2023 diff hist +5 XB-FEAT-486273 →c3 current
- 08:0708:07, 13 September 2023 diff hist +4 XB-FEAT-923124 →il1rapl2 current
17 January 2023
- 10:3710:37, 17 January 2023 diff hist +41 N File:TEFOR icon.png TEFOR - France stock center current
3 May 2022
- 08:0008:00, 3 May 2022 diff hist +300 XB-FEAT-977112 →nomenclature changes current
5 April 2022
- 15:1815:18, 5 April 2022 diff hist 0 File:Q4dorsingle.jpg Xenbase uploaded File:Q4dorsingle.jpg current
- 14:5614:56, 5 April 2022 diff hist −41 Adult Xenopus laevis images No edit summary current
- 14:5614:56, 5 April 2022 diff hist +41 Adult Xenopus laevis images No edit summary
- 14:5314:53, 5 April 2022 diff hist +6 Adult Xenopus laevis images No edit summary
- 14:5214:52, 5 April 2022 diff hist −6 Adult Xenopus laevis images No edit summary
- 12:3412:34, 5 April 2022 diff hist −65 Main Page Undo revision 1 by MediaWiki default (talk) current Tag: Undo