All public logs
Jump to navigation
Jump to search
Combined display of all available logs of XenWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).
- 11:41, 14 February 2024 VG talk contribs created page File:Single embryo to late blastula.mp4
- 11:41, 14 February 2024 VG talk contribs uploaded File:Single embryo to late blastula.mp4
- 11:40, 14 February 2024 VG talk contribs created page File:Single embryo sequence.mp4
- 11:40, 14 February 2024 VG talk contribs uploaded File:Single embryo sequence.mp4
- 11:40, 14 February 2024 VG talk contribs created page File:Short feeding clip 3.mp4
- 11:40, 14 February 2024 VG talk contribs uploaded File:Short feeding clip 3.mp4
- 11:39, 14 February 2024 VG talk contribs created page File:Gastrulation viewed fron anim pole.mp4
- 11:39, 14 February 2024 VG talk contribs uploaded File:Gastrulation viewed fron anim pole.mp4
- 11:38, 14 February 2024 VG talk contribs created page File:Blastopore closure.mp4
- 11:38, 14 February 2024 VG talk contribs uploaded File:Blastopore closure.mp4
- 11:37, 14 February 2024 VG talk contribs created page File:Blastopore closure-neural plate formation.mp4
- 11:37, 14 February 2024 VG talk contribs uploaded File:Blastopore closure-neural plate formation.mp4
- 12:33, 13 February 2024 VG talk contribs created page File:20240213 Bocquet et al - slider.png
- 12:33, 13 February 2024 VG talk contribs uploaded File:20240213 Bocquet et al - slider.png
- 12:33, 13 February 2024 VG talk contribs created page File:20240213 Bocquet et al - Figure 5.jpeg
- 12:33, 13 February 2024 VG talk contribs uploaded File:20240213 Bocquet et al - Figure 5.jpeg
- 12:33, 13 February 2024 VG talk contribs created page File:20240213 Bocquet et al - Figure 3.jpeg
- 12:33, 13 February 2024 VG talk contribs uploaded File:20240213 Bocquet et al - Figure 3.jpeg
- 12:32, 13 February 2024 VG talk contribs created page File:20240213 Bocquet et al - Figure 2.jpeg
- 12:32, 13 February 2024 VG talk contribs uploaded File:20240213 Bocquet et al - Figure 2.jpeg
- 12:32, 13 February 2024 VG talk contribs created page File:20240213 Bocquet et al - graphical abstract.jpeg
- 12:32, 13 February 2024 VG talk contribs uploaded File:20240213 Bocquet et al - graphical abstract.jpeg
- 11:51, 13 February 2024 VG talk contribs created page File:20240213 O Brien et al - Figure 7.jpeg
- 11:51, 13 February 2024 VG talk contribs uploaded File:20240213 O Brien et al - Figure 7.jpeg
- 11:51, 13 February 2024 VG talk contribs created page File:20240213 O Brien et al - Figure 3.jpeg
- 11:51, 13 February 2024 VG talk contribs uploaded File:20240213 O Brien et al - Figure 3.jpeg
- 11:50, 13 February 2024 VG talk contribs created page File:20240213 O Brien et al - Figure 1.jpeg
- 11:50, 13 February 2024 VG talk contribs uploaded File:20240213 O Brien et al - Figure 1.jpeg
- 11:50, 13 February 2024 VG talk contribs created page File:20240213 O Brien et al - slider.png
- 11:50, 13 February 2024 VG talk contribs uploaded File:20240213 O Brien et al - slider.png
- 11:13, 13 February 2024 VG talk contribs created page File:20240213 xenbase valentines day - slider.png
- 11:13, 13 February 2024 VG talk contribs uploaded File:20240213 xenbase valentines day - slider.png
- 11:11, 13 February 2024 VG talk contribs deleted page File:20240213 xenbase valentines day - slider.png
- 11:09, 13 February 2024 VG talk contribs created page File:20240213 xenbase valentines day - slider.png
- 11:09, 13 February 2024 VG talk contribs uploaded File:20240213 xenbase valentines day - slider.png
- 11:08, 13 February 2024 VG talk contribs created page File:20240213 xenopus two frogs.jpg
- 11:08, 13 February 2024 VG talk contribs uploaded File:20240213 xenopus two frogs.jpg
- 09:13, 7 February 2024 Xenbase talk contribs created page XB-FEAT-29209259 (Created page with "=gfod3= There was an assigned model for an ''X. laevis'' ''gfod3.S'' gene but this clashed both in model ID and NCBi gene ID with the ''tp73.S'' gene. Subsequent investigation faored the ''tp73.S'' gene assignment so the model and NCBI gene associateion were removed from ''gfod3.S''. (2/7/2024)")
- 15:32, 5 February 2024 Xenbase talk contribs created page XB-FEAT-29079722 (Created page with "=''gucy2dl''= This is the Xenbase wiki page for the ''Xenopus gucy2dl'' gene(s). Please feel free to record here any relevant information that is not captured elsewhere on Xenbase. =nomenclature changes= 05FEB2024 ''Xenopus'' gene symbol change from LOC100489435 to ''gucy2dl''. Note that true ''gucy2d'', the ortholog of the human GUCY2D gene, is on chromosome 3 in ''X. tropicalis'', and this ''like'' gene is on Chr2.")
- 13:28, 31 January 2024 Xenbase talk contribs created page File:Screenshot 2024-01-31 at 9.06.08 AM.png
- 13:28, 31 January 2024 Xenbase talk contribs uploaded File:Screenshot 2024-01-31 at 9.06.08 AM.png
- 11:32, 31 January 2024 VG talk contribs created page File:20240131 from stem cells to human development - slider.png
- 11:32, 31 January 2024 VG talk contribs uploaded File:20240131 from stem cells to human development - slider.png
- 10:30, 29 January 2024 VG talk contribs created page File:20240129 sdb website image collection - slider.png
- 10:30, 29 January 2024 VG talk contribs uploaded File:20240129 sdb website image collection - slider.png
- 12:41, 24 January 2024 ABell talk contribs created page XB-FEAT-29099062 (Created page with "=''naip.3''= This is the community wiki page for the gene ''naip.3'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase =nomenclature= 24JAN2024 The following synteny was used to determine new gene names for the ''naip'' genes in ''Xenopus tropicalis'' and ''Xenopus laevis''. There are only L subgenome orthologs of the ''naip'' genes in ''X. laevis''. '''''X. tropicalis''''' - ''olcn''> ''gtf2h2...")
- 12:39, 24 January 2024 ABell talk contribs created page XB-FEAT-29091370 (Created page with "=''naip''= This is the community wiki page for the gene ''naip'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase =nomenclature= 24JAN2024 The following synteny was used to determine new gene names for the ''naip'' genes in ''Xenopus tropicalis'' and ''Xenopus laevis''. There are only L subgenome orthologs of the ''naip'' genes in ''X. laevis''. '''''X. tropicalis''''' - ''olcn''> ''gtf2h2''> '...")
- 12:52, 23 January 2024 ABell talk contribs created page XB-FEAT-29085226 (Created page with "=nlrp3l= This is the community wiki page for the gene ''nlrp3l'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase =nomenclature= 23JAN2024 Gene symbol changed from ''LOC101731251'' to ''nlrp3l'' to reflect that it is like the NLRP3 genes in humans, while we work out the specific family and member number of this particular gene in an ongoing review of NLR type genes. Also the ''X. laevis'' L subgen...")
- 16:16, 10 January 2024 VG talk contribs created page File:20240110 Pade et al - Figure 4.jpeg
- 16:16, 10 January 2024 VG talk contribs uploaded File:20240110 Pade et al - Figure 4.jpeg
- 16:15, 10 January 2024 VG talk contribs created page File:20240110 Pade et al - Figure 3.jpeg
- 16:15, 10 January 2024 VG talk contribs uploaded File:20240110 Pade et al - Figure 3.jpeg
- 16:15, 10 January 2024 VG talk contribs created page File:20240110 Pade et al - Figure 1.jpeg
- 16:15, 10 January 2024 VG talk contribs uploaded File:20240110 Pade et al - Figure 1.jpeg
- 16:15, 10 January 2024 VG talk contribs created page File:20240110 Pade et al - graphical abstract.jpeg
- 16:15, 10 January 2024 VG talk contribs uploaded File:20240110 Pade et al - graphical abstract.jpeg
- 16:14, 10 January 2024 VG talk contribs created page File:20240110 Pade et al - slider.png
- 16:14, 10 January 2024 VG talk contribs uploaded File:20240110 Pade et al - slider.png
- 14:36, 9 January 2024 VG talk contribs created page File:20240108 83rd SDB meeting - slider.png
- 14:36, 9 January 2024 VG talk contribs uploaded File:20240108 83rd SDB meeting - slider.png
- 14:36, 9 January 2024 VG talk contribs deleted page File:20240108 83rd SDB meeting - slider.png
- 14:35, 9 January 2024 VG talk contribs created page File:20240108 83rd SDB meeting - slider.png
- 14:35, 9 January 2024 VG talk contribs uploaded File:20240108 83rd SDB meeting - slider.png
- 14:34, 9 January 2024 VG talk contribs deleted page File:20240108 83rd SDB meeting - slider.png (replace with new version)
- 12:09, 8 January 2024 VG talk contribs created page File:20240108 83rd SDB meeting - slider.png
- 12:09, 8 January 2024 VG talk contribs uploaded File:20240108 83rd SDB meeting - slider.png
- 07:03, 8 January 2024 Xenbase talk contribs created page XB-FEAT-22041699 (Created page with "=fim-a.1=")
- 12:24, 4 January 2024 Xenbase talk contribs changed group membership for Christina from (none) to administrator and bureaucrat
- 12:24, 4 January 2024 Xenbase talk contribs changed group membership for Kkarimi from (none) to administrator, interface administrator, bureaucrat and suppressor
- 15:44, 3 January 2024 Xenbase talk contribs created page File:Figure 003.png (pattypan 22.03)
- 15:44, 3 January 2024 Xenbase talk contribs uploaded File:Figure 003.png (pattypan 22.03)
- 15:44, 3 January 2024 Xenbase talk contribs created page File:Figure 002.png (pattypan 22.03)
- 15:44, 3 January 2024 Xenbase talk contribs uploaded File:Figure 002.png (pattypan 22.03)
- 15:43, 3 January 2024 Xenbase talk contribs created page File:Figure 001.png (pattypan 22.03)
- 15:43, 3 January 2024 Xenbase talk contribs uploaded File:Figure 001.png (pattypan 22.03)
- 15:43, 3 January 2024 Xenbase talk contribs created page File:Different terminology for disease terms on pages.jpg (pattypan 22.03)
- 15:43, 3 January 2024 Xenbase talk contribs uploaded File:Different terminology for disease terms on pages.jpg (pattypan 22.03)
- 11:52, 3 January 2024 VG talk contribs created page File:20240103 xenbase wiki image test.png
- 11:52, 3 January 2024 VG talk contribs uploaded File:20240103 xenbase wiki image test.png
- 08:30, 3 January 2024 Xenbase talk contribs created page XB-FEAT-29209255 (Created page with "=nfil3l.2= This is the Xenbase wiki page for the ''Xenopus nfil3l.2'' genes. Please feel free to record here any information about these genes that is not captured elsewhere on Xenbase. =nomenclature changes= 01JAN2024 The ''Xenopus laevis nfil3l.2.L'', nuclear factor interleukin 3 regulated like gene 2 [NCBI GeneID: 447503] is on Chr4L, [v10 gene model: XBXL10_1g19722] and has been placed here on its own gene page. We can not find any paralogous ''nfil3l.2'' gene...")
- 20:23, 15 December 2023 Christina talk contribs created page XB-FEAT-29099462 (Created page with "=smim38= This is the community wiki page for the gene ''smim38'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase =nomenclature= 15DEC2023 The ''X. laevis'' L gene previously annotated as ''LOC121402925.L'' (Xenbase v10 gene model XBXL10_1g17811) is determined to be the L homeolog of the ''smim38'' gene, due to synteny and sequence similarity with ''X. tropicalis'' ''smim38''.")
- 13:57, 14 December 2023 Xenbase talk contribs created page XB-FEAT-22164454 (Created page with "=tff3.5= This is the Xenbase community wiki page for ''Xenopus ''tff3.5'' genes. Please feel free to record here any relevant information about these ones, that is not already represented on the gene page or elsewhere on Xenbase. =genome annotation notes= 12DEC2023 note that ''tff3.5.S'' is not annoatated on the ''X. laevis'' v10 genome release. We looked, and couldn't find a v10.1 model for it.")
- 10:21, 11 December 2023 Xenbase talk contribs created page XB-FEAT-29084766 (Created page with " =protein= uncharacterized protein '''LOC101730711''' [Xenopus tropicalis] NCBI Reference Sequence: XP_017952313.2 >XP_017952313.2 uncharacterized protein LOC101730711 [Xenopus tropicalis] MCHILIFILLFLFLFQRKICEGRGRLSCPAVMGPARLHPFIILLGLFHLFLSSTSAVKVENFTLFEEKLK LEAHTANMIPCVFHTRRRLNPLRVQLEWGKMDKEGYVPLIHLDGNHVRKAAADFGDKYQLFIPQVSQGNC SLVINPMDIADSGTYQVRLRILGKLYEPVPSIEIQVVDQRKVESRAWGKKKTTVPPTTIATVPPGFVDDV QKRLVKIDKMAIIAIILNGVFVGIAILLGVLVFITYRKKSSSGDEENPPKKRKQKGKKEPSDESEESSSS...")
- 10:34, 5 December 2023 Xenbase talk contribs created page XB-FEAT-22169226 (Created page with "=''chst9l.2''=")
- 13:46, 4 December 2023 Xenbase talk contribs created page XB-FEAT-29078026 (Created page with "=''chst1l''= =protein > homology group> nomenclature notes= 12.04.2023 protein: carbohydrate sulfotransferase 1 [Xenopus laevis] NCBI Reference Sequence: XP_018107451.1 >XP_018107451.1 carbohydrate sulfotransferase 1 [Xenopus laevis] MECSWKAVVLLVFASLGIQYTAIKSLRTAFKSPCQVMGGESRCFQRDLRDNASRLLCEDLGQVNRKHIIL LATTRSGSSFLGQIFNQNPDIFYLYEPLYHVQRAFTNSSTRMQKQIDRRSLLGAYRDLLHNLYNCDFYFL ENYLRPAPKDHETTSFFRRGASNALCLPPVCEQLHPIEEHLCSKKCRTVNLTLVSKSCHQYKHMAIKTVR IPEINDIRTLVEDPRLNLKVIH...")
- 07:46, 30 November 2023 Xenbase talk contribs created page File:Six6 synteny.png
- 07:46, 30 November 2023 Xenbase talk contribs uploaded File:Six6 synteny.png
- 14:12, 18 October 2023 Xenbase talk contribs created page File:Screenshot 2023-10-18 at 4.10.09 PM.png
- 14:12, 18 October 2023 Xenbase talk contribs uploaded File:Screenshot 2023-10-18 at 4.10.09 PM.png
- 13:38, 18 October 2023 Xenbase talk contribs created page XB-FEAT-18034121 (Created page with "=''rho.2''= This is the community wiki page for the ''Xenopus rho.2'' genes. Please add here any relevant information pertaining to these genes, if it is not represented elsewhere on Xenbase. =annotation and synteny= Note that this gene is a duplicate of the adjacent ''rho'' gene, on Chromosome 4, but is only seen in ''X. laeivs'' L subgenome. In v10 assemblies: ''Xtr.chr4: mbd4< ift122> rho> h1-8> plxnd1<'' ''Xla.4L:mbd4.L< ift122.L> rho.L> '''rho.2.L>''' h1-8.L>...")
- 12:00, 18 October 2023 Xenbase talk contribs created page XB-FEAT-22065720 (Created page with "=opn7a= =summary from NCBI= Predicted to enable G protein-coupled receptor activity and photoreceptor activity. Acts upstream of or within phototransduction. Predicted to be located in membrane. Predicted to be integral component of membrane. Is expressed in several structures, including brain; digestive system; eye; heart; and testis. [provided by Alliance of Genome Resources, Apr 2022]")
- 13:01, 17 October 2023 Xenbase talk contribs created page XB-FEAT-29083966 (Created page with "= opn6bl= This is the Xenbase wiki page for the Xenopus genes 'opn6bl''. Fee; free to record anything here about these genes a=thata are not recorded elsewhere on Xenbase. =nomenclature changes= 18OCT2023 The gene symbol and names for the opsin gens where updated, provisionally, replacing the ''LOC 100497987, visual pigment-like receptor peropsin'' with ''opn6bl, visual pigment-like receptor peropsin 6b like'', which combines the X.tropicalis gene /protein name with th...")
- 08:03, 10 October 2023 Xenbase talk contribs created page XB-FEAT-22063928 (Created page with "=''notch4''= This is the community wiki page for the gene ''notch4'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase. =gene nomenclature and annotation notes= In ''X. laevis'', on chromosome 8L, LOC121397048 is the gene next to ''tap2.L'' and we propose that represents a non-coding fragment of ''notch4''. This annotation was based on BLAST of notch4.S XM_041575228.1, which identified the loci n...")
- 14:49, 9 October 2023 Xenbase talk contribs created page File:Undefined-4.pdf
- 14:49, 9 October 2023 Xenbase talk contribs uploaded File:Undefined-4.pdf
- 14:48, 9 October 2023 Xenbase talk contribs created page File:Undefined-3.pdf
- 14:48, 9 October 2023 Xenbase talk contribs uploaded File:Undefined-3.pdf
- 13:02, 9 October 2023 Xenbase talk contribs created page XB-FEAT-22062677 (Created page with "=''cx38''= This is the community wiki page for the gene ''cx38'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in Xenbase. =nomenclature= 09 OCTOBER 2023 Note: no other vertebrate genes are called ''cx38'', just ''X. trop'' GeneID:100170463, and ''X. laevis'' GeneID:397866. The Synonym given is ''gja2'', which in NCBI is currently only assigned to genes in a large number of fish species, but no other vert...")
- 15:14, 5 October 2023 Xenbase talk contribs created page File:Stage44ventral.jpg
- 15:14, 5 October 2023 Xenbase talk contribs uploaded File:Stage44ventral.jpg
- 13:22, 5 October 2023 Xenbase talk contribs uploaded File:Herbimycin.png
- 10:51, 5 October 2023 Xenbase talk contribs uploaded File:Krylov FISH-TSA protocol.pdf
- 10:50, 5 October 2023 Xenbase talk contribs uploaded File:Slc45a2 - Start Codon - Consensus.pdf
- 10:50, 5 October 2023 Xenbase talk contribs uploaded File:Slc45a2 - tBLASTn.pdf
- 10:49, 5 October 2023 Xenbase talk contribs uploaded File:Slc45a2 - Multi-sequence alignment.pdf
- 07:45, 2 October 2023 Xenbase talk contribs created page XB-FEAT-29093450 (Created page with "=''cyp27a1.2''= his is the community wiki page for the gene ''cyp27a1.2'' please feel free to add any information that is relevant to this gene that is not already captured el...")
- 12:39, 26 September 2023 Xenbase talk contribs created page XB-FEAT-29072323 (Created page with "=''b3galt2l.9''= This is the community wiki page for the gene ''b3galt2l.9'' please feel free to add any information that is relevant to this gene that is not already capture...")
- 12:38, 26 September 2023 Xenbase talk contribs created page XB-FEAT-29072343 (Created page with "=''b3galt2l.8''= This is the community wiki page for the gene ''b3galt2l.8'' please feel free to add any information that is relevant to this gene that is not already capture...")
- 12:37, 26 September 2023 Xenbase talk contribs created page XB-FEAT-29072311 (Created page with "=''b3galt2l.7''= This is the community wiki page for the gene ''b3galt2l.7'' please feel free to add any information that is relevant to this gene that is not already capture...")
- 12:35, 26 September 2023 Xenbase talk contribs created page XB-FEAT-29072339 (Created page with "=''b3galt2l.6''= This is the community wiki page for the gene ''b3galt2l.6'' please feel free to add any information that is relevant to this gene that is not already capture...")
- 12:33, 26 September 2023 Xenbase talk contribs created page XB-FEAT-29072396 (Created page with "=''b3galt2l.5''= This is the community wiki page for the gene ''b3galt2l.5'' please feel free to add any information that is relevant to this gene that is not already capture...")
- 12:32, 26 September 2023 Xenbase talk contribs created page XB-FEAT-29072315 (Created page with "=''b3galt2l.4''= This is the community wiki page for the gene ''b3galt2l.4'' please feel free to add any information that is relevant to this gene that is not already capture...")
- 12:31, 26 September 2023 Xenbase talk contribs created page XB-FEAT-29072356 (Created page with "=''b3galt2l.3''= This is the community wiki page for the gene ''b3galt2l.3'' please feel free to add any information that is relevant to this gene that is not already capture...")
- 12:31, 26 September 2023 Xenbase talk contribs created page XB-FEAT-29072368 (Created page with "=''b3galt2l.2''= This is the community wiki page for the gene ''b3galt2l.2'' please feel free to add any information that is relevant to this gene that is not already capture...")
- 12:30, 26 September 2023 Xenbase talk contribs created page XB-FEAT-29072327 (Created page with "=''b3galt2l.12''= This is the community wiki page for the gene ''b3galt2l.12'' please feel free to add any information that is relevant to this gene that is not already captu...")
- 12:30, 26 September 2023 Xenbase talk contribs created page XB-FEAT-29072331 (Created page with "=''b3galt2l.11''= This is the community wiki page for the gene ''b3galt2l.11'' please feel free to add any information that is relevant to this gene that is not already captu...")
- 12:29, 26 September 2023 Xenbase talk contribs created page XB-FEAT-29072376 (Created page with "=''b3galt2l.10''= This is the community wiki page for the gene ''b3galt2l.10'' please feel free to add any information that is relevant to this gene that is not already captu...")
- 12:06, 26 September 2023 Xenbase talk contribs created page XB-FEAT-29072384 (Created page with "=''b3galt2l.13''= This is the community wiki page for the gene ''b3galt2l.13'' please feel free to add any information that is relevant to this gene that is not already captu...")
- 11:49, 26 September 2023 Xenbase talk contribs created page XB-FEAT-29072360 (Created page with "=b3galt2l.1= This is the community wiki page for the gene ''b3galt2l.1'' please feel free to add any information that is relevant to this gene that is not already captured els...")
- 07:50, 20 September 2023 Xenbase talk contribs created page XB-FEAT-6469275 (Created page with " = ''nhsl3''= This is the community wiki page for the gene ''nhsl3'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe...")
- 11:45, 19 September 2023 Xenbase talk contribs created page File:Mhc2.daa2 msa.png
- 11:45, 19 September 2023 Xenbase talk contribs uploaded File:Mhc2.daa2 msa.png
- 07:54, 19 September 2023 Xenbase talk contribs created page XB-FEAT-29081898 (Created page with "=''ces2.7''= This is the community wiki page for the gene ''ces2.7'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe...")
- 16:07, 18 September 2023 Xenbase talk contribs created page XB-FEAT-29096122 (Created page with "=''ces2.5''= This is the community wiki page for the gene ''ces2.5'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe...")
- 15:35, 18 September 2023 Xenbase talk contribs created page XB-FEAT-29081994 (Created page with "=''ces2.2''= This is the community wiki page for the gene ''ces2.2'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe...")
- 15:00, 18 September 2023 Xenbase talk contribs created page File:Screenshot 2023-09-18 at 3.06.15 PM.png
- 15:00, 18 September 2023 Xenbase talk contribs uploaded File:Screenshot 2023-09-18 at 3.06.15 PM.png
- 08:35, 14 September 2023 Xenbase talk contribs created page XB-FEAT-29085838 (Created page with "=''adam33''= This is the community wiki page for the gene ''adam33'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 12:39, 12 September 2023 Christina talk contribs created page XB-FEAT-23659672 (Created page with "=''cxcl8b''=")
- 12:18, 12 September 2023 Christina talk contribs created page XB-FEAT-29208828 (Created page with "=''il18.2''= This is the community wiki page for the gene ''il18.2'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 09:34, 12 September 2023 Christina talk contribs created page XB-FEAT-6460977 (Created page with "=''il22ra1''= This is the community wiki page for the gene ''il22ra1'' please feel free to add any information that is relevant to this gene that is not already captured elsew...")
- 10:06, 11 September 2023 Christina talk contribs created page XB-FEAT-22201451 (Created page with "= flt3lg = This is the community wiki page for the gene ''flt3lg'' please feel free to add any information that is relevant to this gene that is not already captured elsewher...")
- 11:05, 17 August 2023 VG talk contribs created page File:Embryo microinjection.mp4
- 11:05, 17 August 2023 VG talk contribs uploaded File:Embryo microinjection.mp4
- 11:03, 17 August 2023 VG talk contribs created page File:Embryo microinjection.png
- 11:03, 17 August 2023 VG talk contribs uploaded File:Embryo microinjection.png
- 11:01, 17 August 2023 VG talk contribs deleted page File:Embryo microinjection.png
- 11:01, 17 August 2023 VG talk contribs created page File:Embryo microinjection.png
- 11:01, 17 August 2023 VG talk contribs uploaded File:Embryo microinjection.png
- 08:29, 17 August 2023 Christina talk contribs created page XB-FEAT-22068404 (Created page with "=''''= This is the community wiki page for the gene ''vcf1'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in X...")
- 14:13, 16 August 2023 VG talk contribs created page File:Adult xenopus tropicalis 03 albino.mp4
- 14:13, 16 August 2023 VG talk contribs uploaded File:Adult xenopus tropicalis 03 albino.mp4
- 14:11, 16 August 2023 VG talk contribs created page File:Adult xenopus tropicalis 03 albino.png
- 14:11, 16 August 2023 VG talk contribs uploaded File:Adult xenopus tropicalis 03 albino.png
- 14:09, 16 August 2023 VG talk contribs created page File:Adult xenopus tropicalis 02 albino.mp4
- 14:09, 16 August 2023 VG talk contribs uploaded File:Adult xenopus tropicalis 02 albino.mp4
- 14:06, 16 August 2023 VG talk contribs created page File:Adult xenopus tropicalis 02 albino.png
- 14:06, 16 August 2023 VG talk contribs uploaded File:Adult xenopus tropicalis 02 albino.png
- 14:03, 16 August 2023 VG talk contribs created page File:Adult xenopus tropicalis 01 diving.mp4
- 14:03, 16 August 2023 VG talk contribs uploaded File:Adult xenopus tropicalis 01 diving.mp4
- 14:02, 16 August 2023 VG talk contribs created page File:Adult xenopus tropicalis 01 diving.png
- 14:02, 16 August 2023 VG talk contribs uploaded File:Adult xenopus tropicalis 01 diving.png
- 13:57, 16 August 2023 VG talk contribs created page File:Adult xenopus laevis 03 diving.mp4
- 13:57, 16 August 2023 VG talk contribs uploaded File:Adult xenopus laevis 03 diving.mp4
- 13:56, 16 August 2023 VG talk contribs created page File:Adult xenopus laevis 03 diving.png
- 13:56, 16 August 2023 VG talk contribs uploaded File:Adult xenopus laevis 03 diving.png
- 13:52, 16 August 2023 VG talk contribs created page File:Adult xenopus laevis 02.mp4
- 13:52, 16 August 2023 VG talk contribs uploaded File:Adult xenopus laevis 02.mp4
- 13:50, 16 August 2023 VG talk contribs created page File:Adult xenopus laevis 02.png
- 13:50, 16 August 2023 VG talk contribs uploaded File:Adult xenopus laevis 02.png
- 13:45, 16 August 2023 VG talk contribs created page File:Adult xenopus laevis 01 albino.mp4
- 13:45, 16 August 2023 VG talk contribs uploaded File:Adult xenopus laevis 01 albino.mp4
- 13:41, 16 August 2023 VG talk contribs created page File:Adult xenopus laevis 01 albino.png
- 13:41, 16 August 2023 VG talk contribs uploaded File:Adult xenopus laevis 01 albino.png
- 15:35, 12 August 2023 VG talk contribs created page File:Xenopus laevis tadpole head.jpg
- 15:35, 12 August 2023 VG talk contribs uploaded File:Xenopus laevis tadpole head.jpg
- 15:32, 12 August 2023 VG talk contribs created page File:Adult xenopus laevis albino 04.jpg
- 15:32, 12 August 2023 VG talk contribs uploaded File:Adult xenopus laevis albino 04.jpg
- 15:29, 12 August 2023 VG talk contribs created page File:Adult xenopus laevis albino 03.jpg
- 15:29, 12 August 2023 VG talk contribs uploaded File:Adult xenopus laevis albino 03.jpg
- 15:27, 12 August 2023 VG talk contribs created page File:Adult xenopus laevis albino 02.jpg
- 15:27, 12 August 2023 VG talk contribs uploaded File:Adult xenopus laevis albino 02.jpg
- 15:21, 12 August 2023 VG talk contribs created page File:Adult xenopus laevis albino 01.jpg
- 15:21, 12 August 2023 VG talk contribs uploaded File:Adult xenopus laevis albino 01.jpg
- 15:20, 12 August 2023 VG talk contribs created page File:Adult xenopus laevis 25 amplex.jpg
- 15:20, 12 August 2023 VG talk contribs uploaded File:Adult xenopus laevis 25 amplex.jpg
- 15:17, 12 August 2023 VG talk contribs created page File:Adult xenopus laevis 24.jpg
- 15:17, 12 August 2023 VG talk contribs uploaded File:Adult xenopus laevis 24.jpg
- 15:15, 12 August 2023 VG talk contribs created page File:Adult xenopus laevis 23.jpg
- 15:15, 12 August 2023 VG talk contribs uploaded File:Adult xenopus laevis 23.jpg
- 15:14, 12 August 2023 VG talk contribs created page File:Adult xenopus laevis 22.jpg
- 15:14, 12 August 2023 VG talk contribs uploaded File:Adult xenopus laevis 22.jpg
- 15:12, 12 August 2023 VG talk contribs created page File:Adult xenopus laevis 21.jpg
- 15:12, 12 August 2023 VG talk contribs uploaded File:Adult xenopus laevis 21.jpg
- 15:11, 12 August 2023 VG talk contribs created page File:Adult xenopus laevis 20.jpg
- 15:11, 12 August 2023 VG talk contribs uploaded File:Adult xenopus laevis 20.jpg
- 15:09, 12 August 2023 VG talk contribs created page File:Adult xenopus laevis 19.jpg
- 15:09, 12 August 2023 VG talk contribs uploaded File:Adult xenopus laevis 19.jpg
- 15:06, 12 August 2023 VG talk contribs created page File:Adult xenopus laevis 18.jpg
- 15:06, 12 August 2023 VG talk contribs uploaded File:Adult xenopus laevis 18.jpg
- 15:05, 12 August 2023 VG talk contribs created page File:Adult xenopus laevis 17.jpg
- 15:05, 12 August 2023 VG talk contribs uploaded File:Adult xenopus laevis 17.jpg
- 15:04, 12 August 2023 VG talk contribs created page File:Adult xenopus laevis 16.jpg
- 15:04, 12 August 2023 VG talk contribs uploaded File:Adult xenopus laevis 16.jpg
- 14:59, 12 August 2023 VG talk contribs created page File:Adult xenopus laevis 15.jpg
- 14:59, 12 August 2023 VG talk contribs uploaded File:Adult xenopus laevis 15.jpg
- 14:58, 12 August 2023 VG talk contribs created page File:Adult xenopus laevis 14.jpg
- 14:58, 12 August 2023 VG talk contribs uploaded File:Adult xenopus laevis 14.jpg
- 14:54, 12 August 2023 VG talk contribs created page File:Adult xenopus laevis 13.jpg
- 14:54, 12 August 2023 VG talk contribs uploaded File:Adult xenopus laevis 13.jpg
- 14:51, 12 August 2023 VG talk contribs created page File:Adult xenopus laevis 12.jpg
- 14:51, 12 August 2023 VG talk contribs uploaded File:Adult xenopus laevis 12.jpg
- 14:40, 12 August 2023 VG talk contribs created page File:Adult xenopus laevis 11.jpg
- 14:40, 12 August 2023 VG talk contribs uploaded File:Adult xenopus laevis 11.jpg
- 14:38, 12 August 2023 VG talk contribs created page File:Adult xenopus laevis 10.jpg
- 14:38, 12 August 2023 VG talk contribs uploaded File:Adult xenopus laevis 10.jpg
- 14:36, 12 August 2023 VG talk contribs created page File:Adult xenopus laevis 09.jpg
- 14:36, 12 August 2023 VG talk contribs uploaded File:Adult xenopus laevis 09.jpg
- 14:34, 12 August 2023 VG talk contribs created page File:Adult xenopus laevis 08.jpg
- 14:34, 12 August 2023 VG talk contribs uploaded File:Adult xenopus laevis 08.jpg
- 14:32, 12 August 2023 VG talk contribs created page File:Adult xenopus laevis 07.jpg
- 14:32, 12 August 2023 VG talk contribs uploaded File:Adult xenopus laevis 07.jpg
- 14:30, 12 August 2023 VG talk contribs created page File:Adult xenopus laevis 06.jpg
- 14:30, 12 August 2023 VG talk contribs uploaded File:Adult xenopus laevis 06.jpg
- 14:29, 12 August 2023 VG talk contribs created page File:Adult xenopus laevis 05.jpg
- 14:29, 12 August 2023 VG talk contribs uploaded File:Adult xenopus laevis 05.jpg
- 14:25, 12 August 2023 VG talk contribs created page File:Adult xenopus laevis 04.jpg
- 14:25, 12 August 2023 VG talk contribs uploaded File:Adult xenopus laevis 04.jpg
- 14:13, 12 August 2023 VG talk contribs created page File:Adult xenopus laevis 03.jpg
- 14:13, 12 August 2023 VG talk contribs uploaded File:Adult xenopus laevis 03.jpg
- 14:11, 12 August 2023 VG talk contribs created page File:Adult xenopus laevis 02.jpg
- 14:11, 12 August 2023 VG talk contribs uploaded File:Adult xenopus laevis 02.jpg
- 14:08, 12 August 2023 VG talk contribs created page File:Adult xenopus laevis 01.jpg
- 14:08, 12 August 2023 VG talk contribs uploaded File:Adult xenopus laevis 01.jpg
- 15:19, 11 August 2023 VG talk contribs created page File:Another short feeding clip.mp4
- 15:19, 11 August 2023 VG talk contribs uploaded File:Another short feeding clip.mp4
- 15:17, 11 August 2023 VG talk contribs created page File:Another short feeding clip.png
- 15:17, 11 August 2023 VG talk contribs uploaded File:Another short feeding clip.png
- 15:13, 11 August 2023 VG talk contribs created page File:Short feeding clip 3.mov
- 15:13, 11 August 2023 VG talk contribs uploaded File:Short feeding clip 3.mov
- 15:11, 11 August 2023 VG talk contribs created page File:Short feeding clip 3.png
- 15:11, 11 August 2023 VG talk contribs uploaded File:Short feeding clip 3.png
- 15:07, 11 August 2023 VG talk contribs created page File:Tadpole.mp4
- 15:07, 11 August 2023 VG talk contribs uploaded File:Tadpole.mp4
- 15:05, 11 August 2023 VG talk contribs created page File:Tadpole.png
- 15:05, 11 August 2023 VG talk contribs uploaded File:Tadpole.png
- 14:59, 11 August 2023 VG talk contribs created page File:Xenbase1920x1080.mov
- 14:59, 11 August 2023 VG talk contribs uploaded File:Xenbase1920x1080.mov
- 14:58, 11 August 2023 VG talk contribs created page File:Xenbase1920x1080.png
- 14:58, 11 August 2023 VG talk contribs uploaded File:Xenbase1920x1080.png
- 14:54, 11 August 2023 VG talk contribs created page File:Xenbase-single cleaving embryo1920x1080.mov
- 14:54, 11 August 2023 VG talk contribs uploaded File:Xenbase-single cleaving embryo1920x1080.mov
- 14:53, 11 August 2023 VG talk contribs created page File:Xenbase-single cleaving embryo1920x1080.png
- 14:53, 11 August 2023 VG talk contribs uploaded File:Xenbase-single cleaving embryo1920x1080.png
- 14:48, 11 August 2023 VG talk contribs created page File:When it all goes wrong - med.mp4
- 14:48, 11 August 2023 VG talk contribs uploaded File:When it all goes wrong - med.mp4
- 14:46, 11 August 2023 VG talk contribs created page File:When it all goes wrong - med.png
- 14:46, 11 August 2023 VG talk contribs uploaded File:When it all goes wrong - med.png
- 14:40, 11 August 2023 VG talk contribs created page File:When it all goes wrong.mov
- 14:40, 11 August 2023 VG talk contribs uploaded File:When it all goes wrong.mov
- 14:38, 11 August 2023 VG talk contribs created page File:When it all goes wrong.png
- 14:38, 11 August 2023 VG talk contribs uploaded File:When it all goes wrong.png
- 14:34, 11 August 2023 VG talk contribs created page File:Single embryo to late blastula.mov
- 14:34, 11 August 2023 VG talk contribs uploaded File:Single embryo to late blastula.mov
- 14:33, 11 August 2023 VG talk contribs created page File:Single embryo to late blastula.png
- 14:33, 11 August 2023 VG talk contribs uploaded File:Single embryo to late blastula.png
- 12:57, 11 August 2023 VG talk contribs created page File:Single embryo sequence.mov
- 12:57, 11 August 2023 VG talk contribs uploaded File:Single embryo sequence.mov
- 12:56, 11 August 2023 VG talk contribs created page File:Single embryo sequence.png
- 12:56, 11 August 2023 VG talk contribs uploaded File:Single embryo sequence.png
- 12:52, 11 August 2023 VG talk contribs created page File:Gastrulation viewed fron anim pole.mov
- 12:52, 11 August 2023 VG talk contribs uploaded File:Gastrulation viewed fron anim pole.mov
- 12:50, 11 August 2023 VG talk contribs created page File:Gastrulation viewed fron anim pole.png
- 12:50, 11 August 2023 VG talk contribs uploaded File:Gastrulation viewed fron anim pole.png
- 12:46, 11 August 2023 VG talk contribs created page File:Blastopore formation.mp4
- 12:46, 11 August 2023 VG talk contribs uploaded File:Blastopore formation.mp4
- 12:45, 11 August 2023 VG talk contribs created page File:Blastopore formation.png
- 12:45, 11 August 2023 VG talk contribs uploaded File:Blastopore formation.png
- 12:39, 11 August 2023 VG talk contribs created page File:Blastopore closure.mov
- 12:39, 11 August 2023 VG talk contribs uploaded File:Blastopore closure.mov
- 12:38, 11 August 2023 VG talk contribs created page File:Blastopore closure.png
- 12:38, 11 August 2023 VG talk contribs uploaded File:Blastopore closure.png
- 12:30, 11 August 2023 VG talk contribs created page File:Blastopore closure-neural plate formation.mov
- 12:30, 11 August 2023 VG talk contribs uploaded File:Blastopore closure-neural plate formation.mov
- 12:28, 11 August 2023 VG talk contribs created page File:Blastopore closure-neural plate formation.png
- 12:28, 11 August 2023 VG talk contribs uploaded File:Blastopore closure-neural plate formation.png
- 11:42, 11 August 2023 VG talk contribs created page File:3 chambered heart.mp4
- 11:42, 11 August 2023 VG talk contribs uploaded File:3 chambered heart.mp4
- 11:02, 11 August 2023 VG talk contribs created page File:3 chambered heart.png
- 11:02, 11 August 2023 VG talk contribs uploaded File:3 chambered heart.png
- 13:47, 26 July 2023 Christina talk contribs created page XB-FEAT-29208211 (Created page with "=''il17a.2''= =nomenclature changes= 27JULY2023 Three genes were annotated in the v10 assembly as ''il17a-like'' on the same section of Chromosome 5L. These have been provis...")
- 13:38, 26 July 2023 Christina talk contribs created page XB-FEAT-29208203 (Created page with "=''il17a''= =nomenclature changes= Three genes were annotated in the v10 assembly as ''il17a-like'' on the same section of Chromosome 5L. These have been provisionally given...")
- 13:20, 26 July 2023 Christina talk contribs created page XB-FEAT-29208219 (Created page with "=''il17a.3''= =nomenclature changes= Three''il17a'' genes were annotated as ''il17a-like'' omn Chromosome 5L/5S. in the ''X. laevis'' v10.1 annotation. These genes are now p...")
- 10:44, 14 July 2023 Christina talk contribs created page XB-FEAT-29079666 (Created page with "=''btnl10'' = This is the community wiki page for the gene ''btnl10'' please feel free to add any information that is relevant to this gene that is not already captured else...")
- 08:42, 14 July 2023 Christina talk contribs created page XB-FEAT-29081262 (Created page with "=''ctss.4''= This is the community wiki page for the ''Xenopus ctss.4'' genes. Please feel free to add any information here, that is relevant to these genes and is not already...")
- 08:23, 14 July 2023 Christina talk contribs created page XB-FEAT-29089970 (Created page with "=''pkn2l.8''= This is the community wiki page for the ''Xenopus pkn2l.8'' genes. Please feel free to add any information here, that is relevant to these genes and is not alrea...")
- 07:57, 14 July 2023 Christina talk contribs created page XB-FEAT-29087614 (Created page with "=''pkn2l.7''= This is the community wiki page for the ''Xenopus pkn2l.7'' genes. Please feel free to add any information here, that is relevant to these genes and is not alre...")
- 07:34, 14 July 2023 Christina talk contribs created page XB-FEAT-29091126 (Created page with " = ''stk38l2'' = This is the community wiki page for the ''Xenopus stk38l2'' genes. Please feel free to add any information here, that is relevant to these genes and is not al...")
- 07:20, 14 July 2023 Christina talk contribs created page XB-FEAT-29089974 (Created page with " =''pkn2l.6''= This is the community wiki page for the ''Xenopus pkn2l.6'' genes. Please feel free to add any information here, that is relevant to these genes and is not alre...")
- 07:06, 14 July 2023 Christina talk contribs created page XB-FEAT-29089902 (Created page with "=''akt1l''= This is the community wiki page for the ''Xenopus'' ''akt1l'' genes. Please feel free to add any information here, that is relevant to these genes and is not alrea...")
- 15:23, 13 July 2023 Christina talk contribs created page XB-FEAT-29079534 (Created page with "=''pkn2l.5''= This is the community wiki page for the ''Xenopus pkn2l.5'' genes. Please feel free to add any information here, that is relevant to these genes and is not alrea...")
- 15:16, 13 July 2023 Christina talk contribs created page XB-FEAT-29089978 (Created page with "=''pkn2l.4''= This is the community wiki page for the Xenopus pkn2l.4 genes. Please feel free to add any information here, that is relevant to these genes and is not already c...")
- 15:10, 13 July 2023 Christina talk contribs created page XB-FEAT-29092170 (Created page with "= '' pkn1l.2'' = This is the community wiki page for the '' Xenopus '' ''pkn1l.2'' genes. Please feel free to add any information here, that is relevant to these genes and...")
- 15:06, 13 July 2023 Christina talk contribs created page XB-FEAT-29091846 (Created page with "= '' pkn1l'' = This is the community wiki page for the '' Xenopus '' ''pkn1l '' genes. Please feel free to add any information here, that is relevant to these genes and is...")
- 14:54, 13 July 2023 Christina talk contribs created page XB-FEAT-29079470 (Created page with "=''pkn2l.3''= This is the community wiki page for the ''Xenopus'' ''pkn2l.3'' genes. Please feel free to add any information here, that is relevant to these genes and is not a...")
- 14:49, 13 July 2023 Christina talk contribs created page XB-FEAT-29091842 (Created page with "= ''pnk2l.2'' = This is the community wiki page for the '' Xenopus' '' ''pnk2l.2'' genes. Please feel free to add any information here, that is relevant to these genes and...")
- 14:38, 13 July 2023 Christina talk contribs created page XB-FEAT-29085518 (Created page with "= pkn2l = This is the community wiki page for the '' Xenopus '' ''pkn2l '' genes. Please feel free to add any information here, that is relevant to these genes and is not al...")
- 14:28, 13 July 2023 Christina talk contribs created page XB-FEAT-29089986 (Created page with "= '' ctss.3'' = This is the community wiki page for the '' Xenopus '' ''ctss.3'' genes. Please feel free to add any information here, that is relevant to these genes and is...")
- 14:14, 13 July 2023 Christina talk contribs created page XB-FEAT-29098998 (Created page with " =protein sequence= XB used this protein accession to characterize this gene: >NP_001076821.2 uncharacterized protein LOC594890 precursor [Xenopus tropicalis] MGFYRQCLIGLFALL...")
- 13:55, 13 July 2023 Christina talk contribs created page XB-FEAT-29098938 (Created page with " =gene nomenclature updates= 13 JULY 2023 ''Xenopus'' gene symbol changed from ''LOC448216'' to ''ctsk.2'' ''Xenopus'' gene from ''cathepsin K (pycnodysostosis)'' to ''cath...")
- 13:42, 13 July 2023 Christina talk contribs created page XB-FEAT-29098762 (Created page with "=''rps6ka4l''= This is the community wiki page for the '' Xenopus '' ''rps6ka4l '' genes. Please feel free to add any information here, that is relevant to these genes but t...")
- 13:22, 13 July 2023 Christina talk contribs created page XB-FEAT-29098926 (Created page with "=''ccnb5''= =nomenclature updates= 05JULY 2023 ''Xenopus'' gene symbol changed from ''LOC394448'' to ''ccnb5''. This change is supported by DIOPT/EggNog analaysis, which m...")
- 14:58, 11 July 2023 Xenbase talk contribs changed group membership for VG from (none) to administrator, interface administrator and bureaucrat
- 09:32, 6 July 2023 User account VG talk contribs was created by Xenbase talk contribs and password was sent by email
- 11:10, 21 June 2023 Christina talk contribs created page XB-FEAT-29087790 (Created page with "=RefSeq protein accession= >XP_031760301.1 gastrula zinc finger protein XlCGF26.1-like [Xenopus tropicalis] MRFCSTQNLLIHQRIHTGRSFVCSKCGKYFSHRKILIAHKWVHTGRKPFTCTESNKGFLWNRDLQQH...")
- 11:00, 21 June 2023 Christina talk contribs created page XB-FEAT-29077586 (Created page with "=refSeq protein accession= XP_031760308.1 gastrula zinc finger protein XlCGF57.1-like isoform X1 [Xenopus tropicalis] MEINPVMTTVLQTNNNTMSGPTPVTSEVPIESPKTNQLSKGQRPGKPFVCAKCKRRF...")
- 10:55, 21 June 2023 Christina talk contribs created page XB-FEAT-29097482 (Created page with "=''znf33bl''= This is the community wiki page for ''Xenopus'' ''znf33bl'' genes. Please record here any relenat information that is not captured elsewhere on Xenbase. =nomenc...")
- 10:38, 21 June 2023 Christina talk contribs created page XB-FEAT-29099066 (Created page with "=''znf24l ''= This is the Xenbase wiki page for ''Xenopus '' ''znf24l'' genes. Please record here any relevant information about ''znf24l'' not captured elsewhere on Xenbase....")
- 10:26, 21 June 2023 Christina talk contribs created page XB-FEAT-29091390 (Created page with "== =nomenclature changes= 20JUNE2023 ''Xenopus'' gene name changed from ''gastrula zinc finger protein XlCGF8.2DB-like'' to ''zinc finger and SCAN domain containing 32 like''...")
- 16:44, 16 June 2023 Christina talk contribs created page XB-FEAT-22063241 (Created page with "=nomenclature changes= 18JUNE2023 Gene name and symbol was updated from ''XB22063241 provisional ortholog of lymphocyte antigen 6 complex, locus A2'' to ''ly6g6e , lymphocyte...")
- 08:11, 16 June 2023 Christina talk contribs created page XB-FEAT-29093310 (Created page with "=''or5as1''= This is the community wiki page for the ''Xenopus'' ''or5as1'' genes. Please feel free to record here anything relevant to this gene that is not recorded elsewher...")
- 11:14, 15 June 2023 Christina talk contribs created page XB-FEAT-29077890 (Created page with "=cupin1.2= There's a complex evolutionary history of a set of genes including those previously called '''DYNAP''' in the region between C18orf54 and RAB27b. After review fro...")
- 14:45, 8 June 2023 Christina talk contribs created page XB-FEAT-22068128 (Created page with "=''spmip4''= his is the community wiki page for the gene ''spmip4'' please feel free to add any information that is relevant to this gene that is not already captured elsewher...")
- 13:05, 8 June 2023 Christina talk contribs created page XB-FEAT-29071333 (Created page with "=''atrx2''=")
- 10:07, 8 June 2023 Christina talk contribs created page XB-FEAT-22065335 (Created page with "=''msantdl.2 ''= This is the community wiki page for the gene ''msantdl.2 '' please feel free to add any information that is relevant to this gene that is not already capture...")
- 11:56, 7 June 2023 Christina talk contribs created page XB-FEAT-22068619 (Created page with "=''XB22068619 ''= This is the community wiki page for the gene ''XB22068619 '' please feel free to add any information that is relevant to this gene that is not already captu...")
- 11:31, 7 June 2023 Christina talk contribs created page XB-FEAT-25874688 (Created page with "=''trat1l''= This is the community wiki page for the gene ''trat1l'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 11:14, 7 June 2023 Christina talk contribs created page XB-FEAT-22069556 (Created page with "=nomenclature updates= 05 JUNE 2023 ''Xenopus'' gene symbol and gene name has changed for genepage ID: 22069550 From ''mettl7a.3, methyltransferase like 7A, gene 3'' to ''tm...")
- 08:30, 7 June 2023 Christina talk contribs created page XB-FEAT-6464249 (Created page with "=''tektl1''= This is the community wiki page for the gene ''tektl1'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe...")
- 12:53, 6 June 2023 Christina talk contribs created page XB-FEAT-6469233 (Created page with "=nomenclature updates= 05JUNE 2023 Human name has changed for Entrez Gene: 10086. From HERV-H LTR-associating 1 to HHLA1 neighbor of OC90")
- 11:56, 6 June 2023 Christina talk contribs created page XB-FEAT-22065730 (Created page with "=''ocm4.10''= This is the community wiki page for the gene ''ocm4.10'' please feel free to add any information that is relevant to this gene that is not already captured elsew...")
- 11:54, 6 June 2023 Christina talk contribs created page XB-FEAT-22065778 (Created page with "=''ocm4.9''= This is the community wiki page for the gene ''ocm4.9'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe...")
- 11:52, 6 June 2023 Christina talk contribs created page XB-FEAT-22065774 (Created page with "=''ocm4.8''= This is the community wiki page for the gene ''ocm4.8'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe...")
- 11:51, 6 June 2023 Christina talk contribs created page XB-FEAT-22065770 (Created page with "=''ocm4.7''= This is the community wiki page for the gene ''ocm4.7'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe...")
- 11:45, 6 June 2023 Christina talk contribs created page XB-FEAT-22065766 (Created page with "=o''cm4.6''= This is the community wiki page for the gene ''ocm4.6'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe...")
- 12:33, 1 June 2023 Christina talk contribs created page XB-FEAT-22041759 (Created page with "=''znf84l''= This is the Xenbase community wiki page for ''Xenopus'' ''znf84l'' genes. Please feel free to add any information here relevant to ''znf84l'' that is not captured...")
- 14:03, 31 May 2023 Christina talk contribs created page XB-FEAT-18006544 (Created page with "=''lrrn1l''= This is teh community wiki page for the ''Xenopus '' ''lrrn1l'' genes. Please feel free to record here any relevant information about ''lrrn1l'' that is not recor...")
- 10:43, 31 May 2023 Christina talk contribs created page XB-FEAT-18006559 (Created page with "=''atp12al''= This is the community wiki page for ''atp12al''. Please fee free to add here any relevant information about this gene that is not represented elsewhere on Xenbas...")
- 12:48, 30 May 2023 Christina talk contribs created page XB-FEAT-25874530 (haus3)
- 14:51, 26 May 2023 Christina talk contribs created page XB-FEAT-6462368 (Created page with "= ''c8h8orf48''= This is the community wiki page for the ''Xenopus c8h8orf48'' genes. Please feel free to record here any relevant information that is not recorded elsewhere o...")
- 15:27, 25 May 2023 Christina talk contribs created page XB-FEAT-22068108 (Created page with " =orthology inference from protein sequence= the Xtrop protein accession XP_031756970.1 matches C3orf62 genes in DIOPT/EggNog Orthologs group, with 67 proteins in 67 specie...")
- 11:46, 24 May 2023 Christina talk contribs created page XB-FEAT-6461374 (Created page with "=''c6h5orf63''= This is the Xenbase wiki page for the ''Xenopus'' ''c6h5orf63'' genes. Please add any relevant information here that is not represented elsewhere on Xenbase....")
- 11:36, 24 May 2023 Christina talk contribs created page XB-FEAT-25919034 (Created page with "=’’gene symbol’’= This is the Xenbase wiki page for the ‘’Xenopus’’ ‘symbol’’ genes. Please add any relevant information here that is not represented e...")
- 07:24, 24 May 2023 Christina talk contribs created page XB-FEAT-25874677 (Created page with " =’’il9’’= This is the Xenbase wiki page for the ‘’Xenopus’’ ‘il9’’ genes. Please add any relevant information here that is not represented elsewhere o...")
- 09:19, 23 May 2023 Christina talk contribs created page XB-FEAT-22164440 (Created page with "=''prfprl2''= This is the Xenbase wiki page for the ''Xenopus prfprl2'' genes. Please add any relevant information here that is not represented elsewhere on Xenbase. =nomen...")
- 07:26, 23 May 2023 Christina talk contribs created page XB-FEAT-22250296 (Created page with "=''mt-atp8''= This is the Xenbase wiki for ''Xenopus'' ''mt-atp8'' genes. Please feel free to add any information relevant to these genes that is not captured elsewhere on Xe...")
- 14:08, 17 May 2023 Christina talk contribs created page XB-FEAT-18386060 (Created page with "=''cyp27a1.3''=")
- 09:24, 16 May 2023 Christina talk contribs created page XB-FEAT-22069202 (Created page with "=nomenclature changes= 16MAY2023 Xenopus gene was renamed, changing from ''sprr3, small proline rich protein 3'' to ''vgf , VGF nerve growth factor inducible''.")
- 08:51, 16 May 2023 Christina talk contribs created page XB-FEAT-29072295 (Created page with "=tmem86al= This is the community wiki page for teh Xenopus ''tmem86al'' genes. Please feel free to enter here any information relevent to these genes that is not found elsewhe...")
- 08:22, 16 May 2023 Christina talk contribs created page NH-3 (Created page with "==Description== NH-3 is an orally active, reversible thyroid hormone receptor (THR) antagonist with an IC50 of 55 nM. NH-3, a derivative of the selective thyromi-metic GC-1,...")
- 12:18, 9 May 2023 Christina talk contribs created page XB-FEAT-6462861 (Created page with "=''il17rel''= thsi is the community wiki page for the ''Xenopus'' ''il17rel'' genes. Please post here any relevant information about these genes that is not found elsewhere o...")
- 11:18, 9 May 2023 Christina talk contribs created page XB-FEAT-6462903 (Created page with "=''il17rc''= This is the community wiki page for the ''Xenopus'' "il17rc'' genes. Please record here any relevant information about these genes that is not recorded elsewhere...")
- 15:08, 5 May 2023 Christina talk contribs created page XB-FEAT-29071357 (Created page with "=''il12b2''= =nomenclature changes= 05MAy2023 Following recommendation from NCBI RefSeq (RSCOM-449) and Zfin, this gene changed its gene symbol and gene name from ''il12bl,...")
- 09:13, 5 May 2023 Christina talk contribs created page XB-FEAT-29072457 (Created page with "=''anln2''= This is the community wiki page for the gene ''anln2'' please feel free to add any information that is relevant to this gene that is not already captured elsewher...")
- 04:36, 2 May 2023 Christina talk contribs created page XB-FEAT-29072461 (Created page with "=''scrt2''= This is the community wiki page for the gene ''scrt2'' please feel free to add any information that is relevant to this gene that is not already captured elsewher...")
- 11:41, 1 May 2023 Christina talk contribs created page XB-FEAT-12564498 (Created page with "=''col11a2.2''= This is the community wiki page for the gene ''col11a2.2''' please feel free to add any information that is relevant to this gene that is not already captured...")
- 10:27, 1 May 2023 Christina talk contribs created page XB-FEAT-22066239 (Created page with "=''trpv4l''= This is the community wiki page for the gene ''trpv4l'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 11:28, 29 April 2023 Christina talk contribs created page XB-FEAT-6462278 (Created page with "=''trim69''= This is the community wiki page for the gene ''trim69'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 11:26, 29 April 2023 Christina talk contribs created page XB-FEAT-22167848 (Created page with "=''trim39l''= This is the community wiki page for the gene ''trim39l'' please feel free to add any information that is relevant to this gene that is not already captured else...")
- 11:21, 29 April 2023 Christina talk contribs created page XB-FEAT-22065906 (Created page with "=''tmprss2''= This is the community wiki page for the gene ''tmprss2'' please feel free to add any information that is relevant to this gene that is not already captured else...")
- 17:00, 28 April 2023 Christina talk contribs created page XB-FEAT-22061153 (Created page with "=''scamp5''= This is the community wiki page for the gene ''scamp5'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 08:59, 28 April 2023 Christina talk contribs created page XB-FEAT-22063326 (Created page with "=''rbm12b''= This is the community wiki page for the gene ''rbm12b'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 07:42, 28 April 2023 Christina talk contribs created page XB-FEAT-6485433 (Created page with "=''tex12''= This is the community wiki page for the gene ''tex12'' please feel free to add any information that is relevant to this gene that is not already captured elsewher...")
- 07:00, 28 April 2023 Christina talk contribs created page XB-FEAT-17329853 (Created page with "=''muc2l''= This is the community wiki page for the gene ''muc2l'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere...")
- 13:21, 26 April 2023 Christina talk contribs created page XB-FEAT-25875147 (Created page with "=''ncr3lg1l''= This is the community wiki page for the gene ''symbol'' please feel free to add any information that is relevant to this gene that is not already captured elsew...")
- 13:07, 26 April 2023 Christina talk contribs created page XB-FEAT-25874694 (Created page with "=''vtcn1.2''= This is the community wiki page for the gene ''vtcn1.2'' please feel free to add any information that is relevant to this gene that is not already captured else...")
- 12:52, 26 April 2023 Christina talk contribs created page XB-FEAT-22063314 (Created page with "=''yrdc''= This is the community wiki page for the gene ''yrdc'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere...")
- 12:40, 26 April 2023 Christina talk contribs created page XB-FEAT-22062350 (Created page with "=''nat2''= This is the community wiki page for the gene ''nat2'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere...")
- 12:29, 26 April 2023 Christina talk contribs created page XB-FEAT-22064859 (Created page with "=''XB22064859''= This is the community wiki page for the gene ''XB22064859'' please feel free to add any information that is relevant to this gene that is not already capture...")
- 12:24, 26 April 2023 Christina talk contribs created page XB-FEAT-22063310 (Created page with " =NOMENCLATURE CHANGES= 26April2023 ''Xenopus'' gene name changed from XB22063310 [provisional] Xenopus laevis cell surface glycoprotein 1-like, to ''spaca5, sperm acrosome a...")
- 11:39, 26 April 2023 Christina talk contribs created page XB-FEAT-23659525 (Created page with "=''pacs3''= This is the community wiki page for the gene ''pacs3'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere...")
- 10:38, 26 April 2023 Christina talk contribs created page XB-FEAT-17329844 (Created page with "=''symbol''= This is the community wiki page for the gene ''symbol'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 10:34, 26 April 2023 Christina talk contribs created page XB-FEAT-29071321 (Created page with "=''inpp1b''= This is the community wiki page for the gene ''inpp1b'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 09:08, 26 April 2023 Christina talk contribs created page XB-FEAT-22169588 (Created page with "=''ptprvl''= This is the community wiki page for the gene ''ptprvl'' please feel free to add any information that is relevant to this gene that is not already captured elsewhe...")
- 08:47, 26 April 2023 Christina talk contribs created page XB-FEAT-23659530 (Created page with "=''marco''= This is the community wiki page for the gene ''marco'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere...")
- 08:45, 26 April 2023 Christina talk contribs created page XB-FEAT-25875133 (Created page with "=''htr3a.2''= This is the community wiki page for the gene ''htr3a.2'' please feel free to add any information that is relevant to this gene that is not already captured elsew...")
- 08:41, 26 April 2023 Christina talk contribs created page XB-FEAT-29071362 (Created page with "= ''mmp21l''= This is the community wiki page for the gene ''mmp21l'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 08:06, 26 April 2023 Christina talk contribs created page XB-FEAT-25874727 (Created page with "=''arhgap20b''= This is the community wiki page for the gene ''arhgap20b'' please feel free to add any information that is relevant to this gene that is not already captured...")
- 08:05, 26 April 2023 Christina talk contribs created page XB-FEAT-29071395 (Created page with "=''nfil3l''= This is the community wiki page for the gene ''nfil3l'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 12:42, 25 April 2023 Christina talk contribs created page XB-FEAT-22063318 (Created page with "=''xicof6.1l ''= This is the community wiki page for the gene ''xicof6.1l '' please feel free to add any information that is relevant to this gene that is not already capture...")
- 12:41, 25 April 2023 Christina talk contribs created page XB-FEAT-29071391 (Created page with "=''ttc39al''= This is the community wiki page for the gene ''ttc39al'' please feel free to add any information that is relevant to this gene that is not already captured else...")
- 12:39, 25 April 2023 Christina talk contribs created page XB-FEAT-22063306 (Created page with "=''btn1a1 ''= This is the community wiki page for the gene ''btn1a1 '' please feel free to add any information that is relevant to this gene that is not already captured else...")
- 11:28, 25 April 2023 Christina talk contribs created page XB-FEAT-22063245 (Created page with "=''fxyd7''= This is the community wiki page for the gene ''fxyd7'' please feel free to add any information that is relevant to this gene that is not already captured elsewher...")
- 10:26, 25 April 2023 Christina talk contribs created page XB-FEAT-29071329 (Created page with "=''scppa2''= This is the community wiki page for the gene ''scppa2'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 10:20, 25 April 2023 Christina talk contribs created page XB-FEAT-18006570 (Created page with "=''lamtor3l''= This is the community wiki page for the gene ''lamtor3l'' please feel free to add any information that is relevant to this gene that is not already captured el...")
- 10:01, 25 April 2023 Christina talk contribs created page XB-FEAT-6495120 (Created page with "=''flt1''= This is the community wiki page for the gene ''flt1'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere...")
- 08:32, 25 April 2023 Christina talk contribs created page XB-FEAT-22065712 (Created page with "=''LOC100496651''= This is the community wiki page for the gene ''LOC100496651'' please feel free to add any information that is relevant to this gene that is not already cap...")
- 15:00, 24 April 2023 Christina talk contribs created page XB-FEAT-6538722 (Created page with "=''esr-5''= This is the community wiki page for the gene ''esr-5'' please feel free to add any information that is relevant to this gene that is not already captured elsewher...")
- 12:16, 24 April 2023 Christina talk contribs created page XB-FEAT-13579844 (Created page with "=''symbol''= This is the community wiki page for the gene ''symbol'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 11:56, 24 April 2023 Christina talk contribs created page XB-FEAT-22064755 (Created page with "=''c1h22orf15''= This is the community wiki page for the gene ''c1h22orf15'' please feel free to add any information that is relevant to this gene that is not already capture...")
- 10:25, 24 April 2023 Christina talk contribs created page XB-FEAT-6468174 (Created page with "=''symbol''= This is the community wiki page for the gene ''symbol'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 09:59, 24 April 2023 Christina talk contribs created page XB-FEAT-25874652 (Created page with "=bpil= This is the community wiki page for the gene ''bpil'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere in X...")
- 08:39, 20 April 2023 Christina talk contribs created page XB-FEAT-22168636 (Created page with "=tgm3l.2=")
- 07:57, 20 April 2023 Christina talk contribs created page XB-FEAT-6465133 (Created page with "= ''bpifb4''=")
- 11:50, 17 April 2023 Christina talk contribs created page XB-FEAT-22168683 (Created page with "=''acrbp.1''=")
- 10:03, 17 April 2023 Christina talk contribs created page XB-FEAT-22069536 (Created page with "= ''cyp46a1.1'' = =gene nomenclature & synteny= There are 3 named ''Xenopus cyp46a1'' genes, a tadem duplication , ''cyp46a1.1, cyp46a1.2, cyp46a1.3'', all on chr8 [Chr8:90...")
- 12:53, 9 March 2023 BArsh talk contribs created page XB-FEAT-22068066 (Created blank page)
- 12:53, 9 March 2023 BArsh talk contribs created page XB-FEAT-22068060 (Created blank page)
- 12:52, 9 March 2023 BArsh talk contribs created page XB-FEAT-22068078 (Created blank page)
- 12:52, 9 March 2023 BArsh talk contribs created page XB-FEAT-22169681 (Created blank page)
- 12:50, 9 March 2023 BArsh talk contribs created page XB-FEAT-22068120 (Created blank page)
- 14:32, 13 February 2023 BArsh talk contribs created page XB-FEAT-13579858 (Created blank page)
- 14:32, 13 February 2023 BArsh talk contribs created page XB-FEAT-22068114 (Created blank page)
- 14:32, 13 February 2023 BArsh talk contribs created page XB-FEAT-22068100 (Created blank page)
- 08:55, 9 February 2023 Christina talk contribs created page XB-FEAT-25919022 (Created page with "=''zfyve28b''= This is the community wiki page for the gene ''zfyve28b'' please feel free to add any information that is relevant to this gene that is not already captured els...")
- 08:55, 9 February 2023 Christina talk contribs created page XB-FEAT-23659514 (Created page with "=''nell3''= This is the community wiki page for the gene ''nell3'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere...")
- 14:02, 2 February 2023 Christina talk contribs created page XB-FEAT-25919039 (Created page with "=''c1h15orf40''= This is the community wiki page for the gene ''c1h15orf40'' please feel free to add any information that is relevant to this gene that is not already capture...")
- 16:20, 31 January 2023 Christina talk contribs created page XB-FEAT-22201039 (Created page with "=cd8a= =nomenclature changes= 31JAN2023 Human name has changed for Entrez Gene: 925. From CD8a molecule to CD8 subunit alpha")
- 13:44, 31 January 2023 Christina talk contribs created page XB-FEAT-22064220 (Created page with "=''cyp2a6.12''= =nomenlcature changes= based on below analysis, the X. laevis.L model that was repreviously identified and called cyp2a6.12, is now thought to be the cyp2a6.1...")
- 08:25, 26 January 2023 Christina talk contribs created page XB-FEAT-25919015 (Created page with "=''wdcp.2''= This is the community wiki page for the gene ''wdcp.2'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 10:37, 17 January 2023 Xenbase talk contribs created page File:TEFOR icon.png (TEFOR - France stock center)
- 10:37, 17 January 2023 Xenbase talk contribs uploaded File:TEFOR icon.png (TEFOR - France stock center)
- 10:35, 5 January 2023 Christina talk contribs created page XB-FEAT-22065609 (Created page with "= ''sprtn2'' = This is the community wiki page for ''sprtn2'' - please feel free to add any information that is relevant to this gene that is not already captured elsewhere in...")
- 10:18, 5 January 2023 Christina talk contribs created page XB-FEAT-22065605 (Created page with "This is the community wiki page for XB22065605 [provisional:sprtn] - please feel free to add any information that is relevant to this gene that is not already captured elsewhe...")
- 09:53, 5 January 2023 Christina talk contribs created page XB-FEAT-22065613 (Created page with "=''sprtn3''= This is the community wiki page for the gene ''sprtn3'', please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 09:00, 5 January 2023 Christina talk contribs created page XB-FEAT-22065621 (Created page with "=nomenclature notes= 05JAN2023 [cjz] in attempt to give this gene a better gen symbol- looked at NCBI. all NCBi genes with the same name have LOC# symbols, a new symbol base...")
- 07:38, 5 January 2023 Christina talk contribs created page XB-FEAT-22065629 (Created page with "=uncharacterized protein XB22065629= 05JAN2023 =protein identity and function= 04JAN2023 The following protein accessions where run through DIOPT Eggnog to attempt to identif...")
- 14:56, 4 January 2023 Christina talk contribs created page XB-FEAT-22065716 (Created page with "=orthology search= 1) uncharacterized protein LOC100487575 [Xenopus tropicalis] NCBI Reference Sequence: XP_002940652.1 MARPLNDGKPSEPVGNIQVETSHAFPAGVAETPCGRICEQSLPSSHPSTTNHSQ...")
- 14:53, 4 January 2023 Christina talk contribs created page XB-FEAT-22068614 (Created page with "=''relt''= This is the community wiki page for the gene ''relt'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere i...")
- 14:43, 4 January 2023 Christina talk contribs created page XB-FEAT-22068624 (Created page with "= ''fndc3c1l'' = This is the community wiki page for the gene ''fndc3c1l'' please feel free to add any information that is relevant to this gene that is not already captured...")
- 14:15, 4 January 2023 Christina talk contribs created page XB-FEAT-22164552 (Created page with " =''csta''= This is the community wiki page for the gene ''csta'' please feel free to add any information that is relevant to this gene that is not already captured elsewhere...")
- 13:53, 4 January 2023 Christina talk contribs created page XB-FEAT-22166267 (Created page with "=''wdr88l''= =nomenlcature changes= 04JAN2023 gene name changed from ''loc100145065'' to ''WD repeat domain 88 like'' gene symbol changed from ''XB22166267'' to ''wdr88l''...")
- 13:29, 4 January 2023 Christina talk contribs created page XB-FEAT-22166511 (Created page with "=''gpr151''= This is the community wiki page for the gene ''gpr151'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 13:28, 4 January 2023 Christina talk contribs created page XB-FEAT-22169457 (Created page with "=''gpr151''= This is the community wiki page for the gene ''gpr151'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 13:20, 4 January 2023 Christina talk contribs created page XB-FEAT-22167168 (Created page with "=rchy1.2= This is the community wiki page for the ''Xenopus'' gene ''rchy1.2''. Feel free to note here anything about ''rchy1.2'' that is not recorded elsewhere on Xenbase....")
- 12:41, 4 January 2023 Christina talk contribs created page XB-FEAT-22169453 (Created page with "=''mgat2l''= This is the community wiki page for the ''Xenopus'' gene ''mgat2l''.Feel free to record here any notes about ''mgat2l'' that are note found elsewhere on Xenbase....")
- 12:07, 4 January 2023 Christina talk contribs created page XB-FEAT-22169469 (Created page with " =''tcrdl''= This is the community page for the ''Xenopus'' gene ''tcrdl''. Feel free to record here any notes about ''tcrdl'' that are not found elsewhere on Xenbase. =nomen...")
- 11:27, 4 January 2023 Christina talk contribs created page XB-FEAT-22169518 (Created page with "=''wadc8l''= This is the community page for the ''Xenopus'' gene ''wadc8l''. Please feel free to add any relevant information here regarding this gene that is not represented...")
- 11:15, 4 January 2023 Christina talk contribs created page XB-FEAT-22169522 (Created page with "==''mypop2''== This is the community page for the ''Xenopus'' gene ''mypop2'', please make notes here about this gene, noting anything that is not recorded elsewhere on Xenbas...")
- 14:10, 20 December 2022 User account Kkarimi talk contribs was created by Xenbase talk contribs and password was sent by email
- 16:31, 9 December 2022 Xenbase talk contribs changed group membership for ABell from (none) to administrator, interface administrator and bureaucrat
- 16:31, 9 December 2022 User account ABell talk contribs was created by Xenbase talk contribs and password was sent by email
- 16:30, 9 December 2022 Xenbase talk contribs changed group membership for Mfisher from (none) to administrator, interface administrator and bureaucrat
- 12:53, 7 December 2022 Christina talk contribs created page XB-FEAT-22064790 (Created page with "=''htr7l''= =annotation notes= 07DEC2022 the gene ID: 101734863 has been deprecated by NCBI, and replaced with gene ID:100486231 for the X. tropicalis ''htr7l'' gene")
- 11:46, 7 December 2022 Christina talk contribs created page XB-FEAT-22068916 (Created page with "=annotation notes= 07DEC2022 The gene model for ''plac8l1'' does not appear in the v10 ''X. tropicalis'' assembly. The Entrez gene ID:101735180 for ''plac8l1'' has subsequ...")
- 10:34, 28 November 2022 Christina talk contribs created page XB-FEAT-23659677 (Created page with "=''cxcl8a.2''= =orthology and nomenclature changes= 28NOV2022 Curartors note: the monthly XB-Entrez gene report from NCBI will flag the following genes, but '''no change i...")
- 15:55, 15 November 2022 Xenbase talk contribs changed group membership for BArsh from (none) to administrator, interface administrator and bureaucrat
- 14:50, 6 October 2022 BArsh talk contribs created page File:Xt4-oligo-design-sequences.txt (Oligo design source sequences Archived from informatics.gurdon.cam.ac.uk xenopus-data)
- 14:50, 6 October 2022 BArsh talk contribs uploaded File:Xt4-oligo-design-sequences.txt (Oligo design source sequences Archived from informatics.gurdon.cam.ac.uk xenopus-data)
- 13:46, 6 October 2022 BArsh talk contribs created page File:Xt-FL-2-clone-map.txt (Full length clones with plate co-ordinates Archived from informatics.gurdon.cam.ac.uk xenopus-data)
- 13:46, 6 October 2022 BArsh talk contribs uploaded File:Xt-FL-2-clone-map.txt (Full length clones with plate co-ordinates Archived from informatics.gurdon.cam.ac.uk xenopus-data)
- 13:34, 6 October 2022 BArsh talk contribs created page File:Xt-FL-2-sequences.fa.txt (Full length clone list in FASTA format Archived from informatics.gurdon.cam.ac.uk xenopus-data)
- 13:34, 6 October 2022 BArsh talk contribs uploaded File:Xt-FL-2-sequences.fa.txt (Full length clone list in FASTA format Archived from informatics.gurdon.cam.ac.uk xenopus-data)
- 11:54, 6 October 2022 BArsh talk contribs created page Full Length Clones (Created page with "{| class="wikitable" |+ Resource files |- |- ! Code !! Date !! Project !! Data File !! Description |- | Xt3.1 || October 2003 || '''Full Length Project'''. ''Xenopus tropicali...")
- 14:32, 23 September 2022 Christina talk contribs created page XB-FEAT-22068419 (Created page with "=nomenclature updates= 23Sept2022 Human symbol has changed for genepage ID: 22068419 From fam169b to FAM169BP ( p suffix indicating a pseudogene) ''Xenopus'' gene is unchang...")
- 14:29, 23 September 2022 Christina talk contribs created page XB-FEAT-22068599 (Created page with "=nomenclature updates= 23Sept2022 Human symbol has changed for genepage ID: 22068599 From XB22068599 [provisional] to linc03048 Human symbol has changed for Entrez Gene: 1001...")
- 14:26, 23 September 2022 Christina talk contribs created page XB-FEAT-22065649 (Created page with "=nomenclature updates= 23Sept2022 Human symbol has changed for genepage ID: 22065649 From zbed6cl to ZBED10P, zinc finger BED-type containing 10, pseudogene Xenopus gene nam...")
- 10:43, 8 September 2022 Christina talk contribs created page XB-FEAT-22065597 (Created page with "=nomenclature changes= 8SEPT2022 gene name changed from ''kif28p'' to ''kif28'', removing the 'p', as this is a protein coding gene in ''Xenopus'', and not a psuedogene as i...")
- 12:35, 7 September 2022 Christina talk contribs created page XB-FEAT-6485412 (Created page with "=nomenclature changes= 7SEPT2022 this gene was renamed from ''xfo1-1, zinc finger protein'' to ''znf251l, Zinc finger family member 251 like'' following a alignmant of the pr...")
- 12:11, 7 September 2022 Christina talk contribs created page XB-FEAT-22065601 (Created page with "=''znf783''= This is the community wiki page for the gene ''znf783'' please feel free to add any information that is relevant to this gene that is not already captured elsewh...")
- 12:30, 31 August 2022 Christina talk contribs created page XB-FEAT-6485500 (Created page with "==''mt-nd4''== =summary for human MT-ND4 from NCBi and teh AGR= Enables NADH dehydrogenase (ubiquinone) activity. Involved in mitochondrial electron transport, NADH to ubiqui...")
- 10:55, 19 August 2022 BArsh talk contribs created page File:XB-IMG-62095.jpg (Yanai et al. 2011 Microarray data: ENSXETG00000001207)
- 10:55, 19 August 2022 BArsh talk contribs uploaded File:XB-IMG-62095.jpg (Yanai et al. 2011 Microarray data: ENSXETG00000001207)
- 09:16, 19 August 2022 Christina talk contribs created page XB-FEAT-25874540 (Created page with "=''mhc2-dmb''= This is the wiki page for ''mhc2-dmb''. Feel free to record here any information that is not found elsewhere on Xenbase. =nomenclature changes= 18AUGUST2022...")
- 11:42, 18 August 2022 Christina talk contribs created page XB-FEAT-22167950 (Created page with "=''mhc1b-uea''= =nomenclature changes= 17August2022 ''Xenopus'' MHC genes are currently under review by Xenbase, Xenopus immunobiologists and the HGNC, these names are there...")
- 14:52, 17 August 2022 User account BArsh talk contribs was created by Xenbase talk contribs
- 12:24, 28 July 2022 Xenbase talk contribs renamed user Christna (0 edits) to Christina
- 12:17, 28 July 2022 User account Christina talk contribs was created by Xenbase talk contribs and password was sent by email
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Q22vensingle.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Screen Shot 2018-01-03 at 1.47.06 PM.png (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Screen Shot 2018-11-16 at 9.34.49 AM.png (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Bumetanide.png (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Xenopus42latsingle copy.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Q49latdraw.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:BIO.png (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Q11antsingle.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Q23vensingle.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Screen Shot 2018-04-09 at 10.21.11 AM.png (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Q15dorsingle.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Q07dorsingledraw.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Literature icon.png (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Q6.5pos.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Q19antsingle.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Q14latsingle.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Qstage22dorsalsingle.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Screen Shot 2019-01-14 at 12.00.28 PM.png (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Q31latsingle.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Screen Shot 2018-01-03 at 1.30.18 PM.png (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:RetinoicAcid.png (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:U0126.png (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Niacin.png (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Qstage21antsingle.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Qstage39latsmallsingle.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Screen Shot 2018-03-26 at 1.12.44 PM.png (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:T3.png (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Q26latsingle.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Community icon.png (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Frog10x-big.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:SodiumNitroprusside.png (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Qstage125postdors.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Q01lat.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Q23latsingle.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Q49vendraw.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Lansoprazole.png (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:FCIS big.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Q48latsingle.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Q12.5possingle.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:LEL 4.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Q47vendrawsingle.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Q50ven.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Q45latsingle.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Xenopus42vensingle copy.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Q21antsingle.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Reagents and protocols 3.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Deltamethrin.png (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:1H3.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Q46vensingle.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:XLRRI icon.png (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Qstage25dorsalsingle.jpg (== Summary == Importing file)
- 17:16, 5 April 2022 Maintenance script talk contribs uploaded File:Qstage29-30latsingle.jpg (== Summary == Importing file)